DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and Rhbdf2

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001100537.2 Gene:Rhbdf2 / 303690 RGDID:1309699 Length:825 Species:Rattus norvegicus


Alignment Length:389 Identity:72/389 - (18%)
Similarity:136/389 - (34%) Gaps:135/389 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MENLTQNVNET-------KVDLGQEKEKEASQEEEHATAAKETIIDIPAACSSSSNSSSY----- 53
            ::.|.::.:||       :.|.....:.:.||::..|....:.    |..|...::|.::     
  Rat   479 IQTLKKDCSETLATFVKWQNDTEPSDKSDLSQKQPSAVVCHQD----PRTCEEPASSGAHIWPDD 539

  Fly    54 -------------------DTDCSTASSTCC----------TR---QGEHIYMQREAIPATPLPE 86
                               ..||......||          ||   :..|.|...||...:.:..
  Rat   540 ITKWPICTEQAQSNRTGLLHIDCKIKGRPCCIGTKGSCEITTREYCEFMHGYFHEEATLCSQVHC 604

  Fly    87 SEDI-GLLKYVHRQHWPWFILVISIIEIAIFAYDRYTMPAQNFGLPVPIPSDSVLVYRPDRRLQV 150
            .::: |||.:::.:                                  ||.            |.
  Rat   605 LDEVCGLLPFLNPE----------------------------------IPD------------QF 623

  Fly   151 WRFFSYMFLHANWFHLGFNIVIQLFFGIPLEVMHGTARIGVIYMAGVFAGSLGTSVVDSEVFL-- 213
            :|.:..:||||...|...::|.|:.....||.:.|..||.:|::.....|:|.     |.:||  
  Rat   624 YRIWLSLFLHAGIVHCLVSVVFQMTILRDLEKLAGWHRISIIFILSGITGNLA-----SAIFLPY 683

  Fly   214 ---VGASGGVYALLAAHLANITLNYAHMK---SASTQLGSVVIFVSCDLGYALYTQYFDGSAFAK 272
               ||.:|..:.|||.....:..::..::   .|...|.::|:|:                 |..
  Rat   684 RAEVGPAGSQFGLLACLFVELFQSWQLLERPWKAFFNLSAIVLFL-----------------FIC 731

  Fly   273 G--PQVSYIAHLTGALAGLTIGFLVLK--NFG--HREYEQLIWWLAL----GVYCAFTVFAIVF 326
            |  |.:..|||:.|.|:|:.:.|..|.  .||  .|..:|.:..::|    |::.:..::..::
  Rat   732 GLLPWIDNIAHIFGFLSGMLLAFAFLPYITFGTSDRYRKQALILVSLLVFAGLFASLVLWLYIY 795

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 40/162 (25%)
Rhbdf2NP_001100537.2 Rhomboid_SP 98..302 CDD:403706
Rhomboid 617..758 CDD:396315 42/208 (20%)
MFS 718..>808 CDD:421695 20/95 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.