DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and Rhbdf1

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_038941805.1 Gene:Rhbdf1 / 303008 RGDID:1305075 Length:907 Species:Rattus norvegicus


Alignment Length:330 Identity:68/330 - (20%)
Similarity:115/330 - (34%) Gaps:100/330 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EASQEEEHATAAKETIIDIPAACSSSSNSSSYDTDCSTASSTCC--TRQGEHI-----------Y 73
            |.|.|:.|......|...|....|:.::::....||......||  |:....|           |
  Rat   609 EPSSEDPHEWPEDITKWPICTKNSAGNHTNHPHMDCVITGRPCCIGTKGRCEITSREYCDFMKGY 673

  Fly    74 MQREAIPATPLPESEDI-GLLKYVHRQHWPWFILVISIIEIAIFAYDRYTMPAQNFGLPVPIPSD 137
            ...||...:.:...:|: |||.:::.:                                      
  Rat   674 FHEEATLCSQVHCMDDVCGLLPFLNPE-------------------------------------- 700

  Fly   138 SVLVYRPDRRLQVWRFFSYMFLHANWFHLGFNIVIQLFFGIPLEVMHGTARIGVIYMAGVFAGSL 202
                 .||   |.:|.:..:||||...|...::..|:.....||.:.|..||.:||:.....|:|
  Rat   701 -----VPD---QFYRLWLSLFLHAGILHCLVSVCFQMTVLRDLEKLAGWHRIAIIYLLSGVTGNL 757

  Fly   203 GTSVVDSEVFL-----VGASGGVYALLAAHLANITLNY---AHMKSASTQLGSVVIFVSCDLGYA 259
            .     |.:||     ||.:|..:.:||.....:..::   |....|..:|.:||:|:       
  Rat   758 A-----SAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFFKLLAVVLFL------- 810

  Fly   260 LYTQYFDGSAFAKGPQVSYIAHLTGALAGLTIGFLVLKNFGHREYEQLIWWLALGVY---CAFTV 321
                    .||...|.:...||::|.::||.:.|..|......:::         :|   |...:
  Rat   811 --------FAFGLLPWIDNFAHISGFVSGLFLSFAFLPYISFGKFD---------LYRKRCQIII 858

  Fly   322 FAIVF 326
            |..||
  Rat   859 FQAVF 863

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 42/160 (26%)
Rhbdf1XP_038941805.1 Rhomboid_SP 142..359 CDD:403706
Rhomboid 699..840 CDD:396315 42/206 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.