DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and Rhbdl2

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_038965543.1 Gene:Rhbdl2 / 298512 RGDID:1308295 Length:302 Species:Rattus norvegicus


Alignment Length:271 Identity:95/271 - (35%)
Similarity:149/271 - (54%) Gaps:36/271 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 ESEDIGLLKYVHR--QHW-------------------PWFILVISIIEIAIFAYDRYTMPAQNF- 128
            |.:|....:.|||  ..|                   |.||::||:.|:|:|.|.....|.:.: 
  Rat    34 EGKDFPRGRKVHRIVSKWMLPEPVRRTYLERANCLPPPLFIVLISLAELAVFIYYAVWKPQKQWI 98

  Fly   129 ----GLPVPIPSDSVLVYRPDRRLQVWRFFSYMFLHANWFHLGFNIVIQLFFGIPLEVMHGTARI 189
                |:     .:|.|.|||::|.:.|||.|||.:||...|:..|:.:||..|||||::|...|:
  Rat    99 TLDTGI-----LESPLTYRPEKREEAWRFISYMLVHAGVQHIVGNLFMQLVLGIPLEMVHKGLRV 158

  Fly   190 GVIYMAGVFAGSLGTSVVDSEVFLVGASGGVYALLAAHLANITLNYAHMKSA--STQLGSVVIFV 252
            |::|:|||.||||.:|:.|....|||||||||||:..:..|:.:|:..|..|  ..:|..:::.|
  Rat   159 GLVYLAGVLAGSLASSIFDPLKSLVGASGGVYALMGGYFMNVIVNFREMIPALGIVRLLVIILIV 223

  Fly   253 SCDLGYALYTQYFDGSAFAKGPQVSYIAHLTGALAGLTIGFLVLKNFGHREYEQLIWWLALGVYC 317
            :.|:|:|||.::|   ..|.|..||:.||:.|..||:::|:.|...|.....:...:|:::..|.
  Rat   224 ASDMGFALYRRFF---VPANGSPVSFAAHIAGGFAGMSVGYTVFSCFDKTLLKDPRFWISIAAYV 285

  Fly   318 AFTVFAIVFNL 328
            |..:||:.||:
  Rat   286 ACLLFAVFFNI 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 66/154 (43%)
Rhbdl2XP_038965543.1 Rhomboid 113..265 CDD:396315 66/154 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107191
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.