DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and rho-5

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster


Alignment Length:196 Identity:48/196 - (24%)
Similarity:83/196 - (42%) Gaps:24/196 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 VLVYRPDRRLQVWRFFSYMFLHANWFHLGFNIVIQLFFGIPLEVMHGTARIGVIYMAGVFAGSLG 203
            :.|..||   |::|..:.:.:||...||...::.|..|...||.:.||.|..::|:...|||:|.
  Fly  1085 ISVETPD---QLYRLLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLT 1146

  Fly   204 TSVVDSEVFLVGAS---GGVYALLAAHLANITLNYAHMKSASTQLGSVVIFVSCDLGYALYTQYF 265
            ::::......||.|   .||.|.|.|.|..:...|.|    ...:....:.:.|.:...:.|..:
  Fly  1147 SAILVPHRPEVGPSASLSGVVASLIALLVWMHWKYLH----KPHIALFKLLLLCSVLVGIGTLPY 1207

  Fly   266 DGSAFAKGPQVSYIAHLTGALAG--LT---IGFLVLKNFGHREYEQLIWWLALGVYCAFTVFAIV 325
                     |::::..|.|.:.|  ||   :.|.....:|.::...|||...|.....:|...:.
  Fly  1208 ---------QLNFLGLLAGVICGCLLTMSLVPFTTFSKYGRKKKINLIWTCVLFHVVVYTAMIVT 1263

  Fly   326 F 326
            |
  Fly  1264 F 1264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 40/160 (25%)
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 37/150 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444952
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3549
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X418
65.740

Return to query results.
Submit another query.