DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and Rhbdl3

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_006533389.1 Gene:Rhbdl3 / 246104 MGIID:2179276 Length:433 Species:Mus musculus


Alignment Length:120 Identity:48/120 - (40%)
Similarity:73/120 - (60%) Gaps:9/120 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PWFILVISIIEIAIFAYDRYTMPAQNFGLPVPIPS--DSVLVYRPDRRLQVWRFFSYMFLHANWF 164
            |||::.|:::|:|:|.|:...:  ..|.|.|..|.  .:.|||.|..|.|.||:.:|:|:||...
Mouse   163 PWFMITITLLEVALFLYNGVLL--DQFVLQVTHPRYLKNSLVYHPQLRAQAWRYVTYIFMHAGVE 225

  Fly   165 HLGFNIVIQLFFGIPLEVMHGTARIGVIYMAGVFAGSLGTSVVDSEVFLVGASGG 219
            .||.|:.:||..|:|||::||..|||::|:|||.|     .:|..||.:..|:.|
Mouse   226 QLGLNVALQLLVGVPLEMVHGATRIGLVYVAGVVA-----ELVRHEVPVQAAADG 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 33/76 (43%)
Rhbdl3XP_006533389.1 EF-hand_7 36..100 CDD:372618
Rhomboid 207..>260 CDD:389796 26/52 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834620
Domainoid 1 1.000 142 1.000 Domainoid score I4661
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5174
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.760

Return to query results.
Submit another query.