DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and Rhbdl1

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_659065.1 Gene:Rhbdl1 / 214951 MGIID:2384891 Length:373 Species:Mus musculus


Alignment Length:350 Identity:107/350 - (30%)
Similarity:174/350 - (49%) Gaps:58/350 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VNETKVDLGQEKEKEASQEEEHATAAKETIIDIPAACSSSSNSSSYDTDCSTASSTCCTRQGEHI 72
            ::.||:|:    ....:|..|......:.::|:    .||..|||:....:..            
Mouse    39 LDPTKLDM----LVALAQSNERGQVCYQELVDL----ISSKRSSSFKRAIANG------------ 83

  Fly    73 YMQREAIPATPLPESEDIGLLK-------------------YVHRQHW---PWFILVISIIEIAI 115
               :.|:|...|.:...:.:.|                   |.:|...   |.|:..:::.:|.:
Mouse    84 ---QRALPRDGLLDEPGLSVYKRFVRYVAYEILPCEVDRRWYFYRHRTCPPPVFMASVTLAQIIV 145

  Fly   116 F-----AYDRYTMPAQNFGLPVPIPSDSVLVYRPDRRLQVWRFFSYMFLHANWFHLGFNIVIQLF 175
            |     ..:::.:...:     |....|.|||.|..|.:.|||.:|||:|.....||||.::||.
Mouse   146 FLCYGARLNKWVLQTYH-----PEYMKSPLVYHPGHRARAWRFLTYMFMHVGLEQLGFNALLQLM 205

  Fly   176 FGIPLEVMHGTARIGVIYMAGVFAGSLGTSVVDSEVFLVGASGGVYALLAAHLANITLNYAHMKS 240
            .|:|||::||..||.::|:|||.||||..|:.|....:||.|||||||.:|||||:.:|:|.|:.
Mouse   206 IGVPLEMVHGVLRISLLYLAGVLAGSLTVSITDMRAPVVGGSGGVYALCSAHLANVVMNWAGMRC 270

  Fly   241 ASTQLGSVVIFV--SCDLGYALYTQYFDGSAFAKGPQVSYIAHLTGALAGLTIGFLVLKNFGHRE 303
            ....|..|:..|  |.::|.|::.: |.....|.|||.|::|||.||:.|:::|..:|:::..|.
Mouse   271 PYKLLRMVLALVCMSSEVGRAVWLR-FSPPLPASGPQPSFMAHLAGAVVGVSMGLTILRSYEERL 334

  Fly   304 YEQLIWWLALGVYCAFTVFAIVFNL 328
            .:|..||:.|..|..|.:|||.:|:
Mouse   335 RDQCGWWVVLLAYGTFLLFAIFWNV 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 69/154 (45%)
Rhbdl1NP_659065.1 Rhomboid 174..328 CDD:279958 69/154 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 142 1.000 Domainoid score I4661
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.