DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and rom-2

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001366679.1 Gene:rom-2 / 183564 WormBaseID:WBGene00004401 Length:348 Species:Caenorhabditis elegans


Alignment Length:264 Identity:80/264 - (30%)
Similarity:144/264 - (54%) Gaps:21/264 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 YMQREAIPATPLPESEDIGLLKYVHRQHW---PWFILVISIIEIAIFAYDRYTM-PAQNFGLPVP 133
            |:.|.|:..|  |:::.|.:...:.|...   |.|::.:||:::|.:.|  |.: .::...|..|
 Worm    92 YLFRAALTVT--PKNQRIHVFSELQRYKCVPPPIFLIFLSIVQLAFYLY--YVVDSSEGVWLSGP 152

  Fly   134 IPSDSVLVYRPDRRLQVWRFFSYMFLHANWFHLGFNIVIQLFFGIPLEVMHGTARIGVIYMAGVF 198
            ||:.|.|:.......::||.|:|..::...||:.|||:|||..|:|||::| ..||.::|..||.
 Worm   153 IPTMSPLIVSQYHLPELWRLFTYCLINVGIFHIIFNILIQLAIGVPLELVH-RWRIYILYFMGVL 216

  Fly   199 AGSLGTSVVDSEVFLVGASGGVYALLAAHLANITLNYAHMKSASTQLGSVVIFVSCDLGYALYTQ 263
            .||:.:..:|..|||.|.:.|.::|:|:|:..|..|:..|::|:.:|..:::|.:.|...|:|.:
 Worm   217 FGSILSLALDPTVFLCGGAAGSFSLIASHITTIATNFKEMENATCRLPILIVFAALDYVLAVYQR 281

  Fly   264 YFDGSAFAKGP---QVSYIAHLTGALAGLTIGFLVLKNFGHREYEQLIWWLALGVYCAFTVFAIV 325
            :|       .|   :||...||.|.:||:...|::.:......:..:.:|::| |...|.: ||.
 Worm   282 FF-------APRIDKVSMYGHLGGLVAGILFTFILFRGSKPSRFYTVSFWVSL-VLSGFFI-AIC 337

  Fly   326 FNLI 329
            ..||
 Worm   338 ITLI 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 52/155 (34%)
rom-2NP_001366679.1 EF-hand_7 21..82 CDD:404394
Rhomboid 165..311 CDD:396315 52/153 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162539
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5174
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107191
Panther 1 1.100 - - O PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.660

Return to query results.
Submit another query.