DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and Rhbdf1

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_036012182.1 Gene:Rhbdf1 / 13650 MGIID:104328 Length:926 Species:Mus musculus


Alignment Length:199 Identity:39/199 - (19%)
Similarity:67/199 - (33%) Gaps:60/199 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EASQEEEHATAAKETIIDIPAACSSSSNSSSYDTDCSTASSTCC--TRQGEHI-----------Y 73
            |.|.|:.|......|...|....|:.::::....||......||  |:....|           |
Mouse   606 EPSSEDPHEWPEDITKWPICTKSSAGNHTNHPHMDCVITGRPCCIGTKGRCEITSREYCDFMRGY 670

  Fly    74 MQREAIPATPLPESEDI-GLLKYVHRQHWPWFILVISIIEIAIFAYDRYTMPAQNFGLPVPIPSD 137
            ...||...:.:...:|: |||.:::.:                                      
Mouse   671 FHEEATLCSQVHCMDDVCGLLPFLNPE-------------------------------------- 697

  Fly   138 SVLVYRPDRRLQVWRFFSYMFLHANWFHLGFNIVIQLFFGIPLEVMHGTARIGVIYMAGVFAGSL 202
                 .||   |.:|.:..:||||...|...::..|:.....||.:.|..||.:||:.....|:|
Mouse   698 -----VPD---QFYRLWLSLFLHAGILHCLVSVCFQMTVLRDLEKLAGWHRIAIIYLLSGITGNL 754

  Fly   203 GTSV 206
            .:::
Mouse   755 ASAI 758

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 19/63 (30%)
Rhbdf1XP_036012182.1 Rhomboid_SP 139..356 CDD:403706
Rhomboid 696..>762 CDD:419717 19/109 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.