DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and Rhbdl1

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_008765759.1 Gene:Rhbdl1 / 117025 RGDID:620699 Length:433 Species:Rattus norvegicus


Alignment Length:350 Identity:109/350 - (31%)
Similarity:177/350 - (50%) Gaps:54/350 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VNETKVDLGQEKEKEASQEEEHATAAKETIIDIPAACSSSSNSSSYDTDCSTASSTCCTRQGEHI 72
            ::.||:|:    ....:|..|......:.::|:.:|..||..|||:....:..            
  Rat    95 LDPTKLDM----LVALAQSNERGQVCYQELVDLVSAMISSKRSSSFKRAIANG------------ 143

  Fly    73 YMQREAIPATPLPESEDIGLLK-------------------YVHRQHW---PWFILVISIIEIAI 115
               :.|:|...|.:...:|:.|                   |.:|...   |.|:..:::.:|.:
  Rat   144 ---QRALPRDGLLDEPGLGIYKRFVRYVAYEILPCEVDRRWYFYRHRTCPPPVFMASVTLAQIIV 205

  Fly   116 F-----AYDRYTMPAQNFGLPVPIPSDSVLVYRPDRRLQVWRFFSYMFLHANWFHLGFNIVIQLF 175
            |     ..:::.:...:     |....|.|||.|..|.:.|||.:|||:|.....||||.::||.
  Rat   206 FLCYGARLNKWVLQTYH-----PEYMKSPLVYHPGHRARAWRFLTYMFMHVGLEQLGFNALLQLM 265

  Fly   176 FGIPLEVMHGTARIGVIYMAGVFAGSLGTSVVDSEVFLVGASGGVYALLAAHLANITLNYAHMKS 240
            .|:|||::||..||.::|:|||.||||..|:.|....:||.|||||||.:|||||:.:|:|.|:.
  Rat   266 IGVPLEMVHGVLRISLLYLAGVLAGSLTVSITDMRAPVVGGSGGVYALCSAHLANVVMNWAGMRC 330

  Fly   241 ASTQLGSVVIFV--SCDLGYALYTQYFDGSAFAKGPQVSYIAHLTGALAGLTIGFLVLKNFGHRE 303
            ....|..|:..|  |.::|.|::.: |.....|.|||.|::|||.||:.|:::|..:|:::..|.
  Rat   331 PYKLLRMVLALVCMSSEVGRAVWLR-FSPPLPASGPQPSFMAHLAGAVVGVSMGLTILRSYEERL 394

  Fly   304 YEQLIWWLALGVYCAFTVFAIVFNL 328
            .:|..||:.|..|..|.:|||.:|:
  Rat   395 RDQCGWWVVLLAYGTFLLFAIFWNV 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 69/154 (45%)
Rhbdl1XP_008765759.1 Rhomboid 234..388 CDD:279958 69/154 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 142 1.000 Domainoid score I4562
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.