DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and rhbdl3

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_031750644.1 Gene:rhbdl3 / 101732375 -ID:- Length:350 Species:Xenopus tropicalis


Alignment Length:232 Identity:100/232 - (43%)
Similarity:148/232 - (63%) Gaps:8/232 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PWFILVISIIEIAIFAYDRYTMPAQNFGLPVPIP---SDSVLVYRPDRRLQVWRFFSYMFLHANW 163
            ||||:.::|:|:|.|.|  |.:....|.|....|   .::.|||.|..|:|.||:.||||:||..
 Frog   104 PWFIITVTIVEVAAFVY--YGLVLDRFVLQATHPRYLRNNPLVYHPQVRVQAWRYLSYMFMHAGI 166

  Fly   164 FHLGFNIVIQLFFGIPLEVMHGTARIGVIYMAGVFAGSLGTSVVDSEVFLVGASGGVYALLAAHL 228
            .|||.|:.:||..|:|||::||..||..:|:||:.||||..||.|:....||||.||||||:|||
 Frog   167 EHLGVNVALQLLVGVPLEMVHGAVRISFVYIAGILAGSLAVSVADTSAPAVGASAGVYALLSAHL 231

  Fly   229 ANITLNYAHMKSASTQLGS--VVIFVSCDLGYALYTQYFDGSAFAKGPQVSYIAHLTGALAGLTI 291
            |||.:|::.||.....|.:  .:|.:|.:.|.|::.:.:. ||:|..|..|::|||.|.|.|:|:
 Frog   232 ANIVMNWSGMKCQFKLLRTAFALICMSFEFGRAVWLRLYP-SAYAPCPHPSFVAHLGGVLVGITL 295

  Fly   292 GFLVLKNFGHREYEQLIWWLALGVYCAFTVFAIVFNL 328
            |.:.|:|:..|..:|.:||:.|.:|..|..||:::|:
 Frog   296 GVITLRNYEQRLRDQSLWWVFLAIYVLFVTFAVLWNI 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 72/154 (47%)
rhbdl3XP_031750644.1 Rhomboid 152..301 CDD:396315 70/149 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 147 1.000 Domainoid score I4466
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 1 1.000 - - mtm9513
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.