DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and rhbdf2

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001090673.1 Gene:rhbdf2 / 100036646 XenbaseID:XB-GENE-966769 Length:826 Species:Xenopus tropicalis


Alignment Length:301 Identity:65/301 - (21%)
Similarity:109/301 - (36%) Gaps:96/301 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DCSTASSTCC----------TRQ---GEHIYMQREAIPATPLPESEDI-GLLKYVHRQHWPWFIL 106
            ||......||          ||:   ..|.|...||...:.:...::: |||.:::.::      
 Frog   562 DCEIKGRPCCIGTKGSCEITTREYCTFMHGYFHEEATLCSQVHCLDEVCGLLPFLNPEY------ 620

  Fly   107 VISIIEIAIFAYDRYTMPAQNFGLPVPIPSDSVLVYRPDRRLQVWRFFSYMFLHANWFHLGFNIV 171
                                                 ||   |.:|.:..:||||...|...::|
 Frog   621 -------------------------------------PD---QFYRLWLSLFLHAGVIHCCVSVV 645

  Fly   172 IQLFFGIPLEVMHGTARIGVIYMAGVFAGSLGTSVVDSEVFL-----VGASGGVYALLAAHLANI 231
            .|:.....||.:.|..||.:||:.....|:|.     |.:||     ||.:|..:.|||.....:
 Frog   646 FQMTVLRDLEKLAGWLRISIIYILSGITGNLA-----SALFLPYRAEVGPAGSQFGLLACLFVEL 705

  Fly   232 TLNY---AHMKSASTQLGSVVIFVSCDLGYALYTQYFDGSAFAKGPQVSYIAHLTGALAGLTIGF 293
            ..::   |....|..:|..:|:|:               ..|...|.:..|||:.|.|:||.:.|
 Frog   706 FQSWQILAKPWKAFLKLLGIVLFL---------------FLFGLLPWIDNIAHIFGFLSGLLLSF 755

  Fly   294 LVLK--NFG----HREYEQLIWWLA--LGVYCAFTVFAIVF 326
            ..|.  .||    .|:...:|..|.  :|::.:..::..|:
 Frog   756 SFLPYITFGTADKFRKRAMIIISLLVFVGLFASLVIWLYVY 796

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 44/160 (28%)
rhbdf2NP_001090673.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..78
Rhomboid_SP 90..287 CDD:372211
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..180
Rhomboid 620..761 CDD:366759 45/206 (22%)
MFS 746..>803 CDD:391944 13/51 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.