DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SA-2 and TRIM74

DIOPT Version :9

Sequence 1:NP_612109.3 Gene:SA-2 / 38167 FlyBaseID:FBgn0043865 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_001304744.1 Gene:TRIM74 / 378108 HGNCID:17453 Length:250 Species:Homo sapiens


Alignment Length:114 Identity:28/114 - (24%)
Similarity:44/114 - (38%) Gaps:35/114 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 TFCQRVK-HLLQLFIECGHEQ--ADYLVDSLIDNCELVLDWKSMIAVLL-----------ENPKS 427
            |.|.|:| .|..||.|...||  .|.|:..|:.|...:::...:.:.::           :..|:
Human   127 TVCSRMKEELAALFSELKQEQKKVDELIAKLVKNRTRIVNESDVFSWVIRREFQELRHPVDEEKA 191

  Fly   428 RELSDI--HCSSLIAILLAGVKQATAGEIPPGRYTKDLKREPRQGAQER 474
            |.|..|  |...|:|.|                   |::.|..||.:||
Human   192 RCLEGIGGHTRGLVASL-------------------DMQLEQAQGTRER 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SA-2NP_612109.3 STAG 134..217 CDD:285686
TRIM74NP_001304744.1 RING 15..60 CDD:238093
BBOX 90..125 CDD:237988
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D167826at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.