DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9173 and CG3517

DIOPT Version :9

Sequence 1:NP_612108.1 Gene:CG9173 / 38165 FlyBaseID:FBgn0035218 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_650807.1 Gene:CG3517 / 42324 FlyBaseID:FBgn0038706 Length:382 Species:Drosophila melanogaster


Alignment Length:325 Identity:87/325 - (26%)
Similarity:137/325 - (42%) Gaps:45/325 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CNCRRKLDPYQLFDDNVEDIAKSLAQIMLICGISTSKSSAARSIIKRAFVYHERLRTNCPPNPAT 90
            |.|..:::...:|.:||.|:|.:|||:|:|||:...|:.:...||..||::::::.......|  
  Fly    36 CKCLGEVNASSIFLENVLDLANTLAQVMIICGLHECKAKSTVDIITYAFLHYDQVCYCIDTTP-- 98

  Fly    91 DSRLNREDLLQALRLKCEMEPVEAMLTYAIIKRAFKAFYHGKPPVTISNPIVDAMAVHTQYAAWM 155
            ..||.:|||...|..|..|..|||.|.||||||.|||||: :|.|.::.. ......:.....|:
  Fly    99 KKRLRKEDLFHELGKKSLMNKVEAHLAYAIIKRGFKAFYY-EPKVDLTYD-EQGRPSYNDECVWV 161

  Fly   156 HAAHKTSRIFDNYKAAFFWAHKHYERQINLVYAALYQRMTTRSDPLLVPGCPCKGCSKQEVPGHP 220
            |||.|::..:..:..........||.:|.:.:...|.||.||........|.|..|:|:.  ||.
  Fly   162 HAARKSAESYARFDGLSCAEQLAYEAKIKIAFKKFYDRMQTRKRQPEGDDCNCCFCAKKR--GHL 224

  Fly   221 KAGQRQMMKIKLSEGADLPEPCIICGLQVPQMDKEVRMKKPPRPIINHEVNLP-RCQQCNSPFLI 284
            ...:.             |.|| ....:.|:.......||..:....|....| :|.:|:.....
  Fly   225 VYAKE-------------PTPC-TSNKKKPKHVCPYCCKKKQKQQYTHPARQPAKCPKCHKSRKF 275

  Fly   285 CECNIDQLTGEQFGECGQDSYKVKWYR-LEEPVAISQPVSQPLGEEEQDTSYDEAVE-----PPE 343
            | |            |.:..:.::|.: :.|....:|.....:.|.|     |..|:     |||
  Fly   276 C-C------------CTKMDFNLQWVKSIWERPDFNQYYKNEIAEIE-----DRLVKGTCWLPPE 322

  Fly   344  343
              Fly   323  322



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FBP3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016624
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.