DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTD and Fut9

DIOPT Version :9

Sequence 1:NP_612107.1 Gene:FucTD / 38164 FlyBaseID:FBgn0035217 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_445917.1 Gene:Fut9 / 84597 RGDID:619955 Length:359 Species:Rattus norvegicus


Alignment Length:342 Identity:86/342 - (25%)
Similarity:127/342 - (37%) Gaps:79/342 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 NLRMILLWNEP-----SLVNAPAHVEC-GCLVTTSRSHNDKAFDAVVISADHPYSFEGLGGVKLH 183
            |...||:|..|     .|.:..|.... ||.:||.||..:|:...::...|..:....|      
  Rat    62 NETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNL------ 120

  Fly   184 PDFYAVYAAKKPL---------SSTQNPLTNFTLPPFNLTMTYRLDSQLIWTDYYFSHTNLARRL 239
            |.     .|:.|.         |.|..|..:.....||||:|||.||. |...|.|         
  Rat   121 PQ-----QARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSD-IQVPYGF--------- 170

  Fly   240 KWFRAPSKSFADDMPATTVLRLESEILKKSRLAVYLVYEVNEKTLPESL---YMEELRKYADLDA 301
              ....:..|..::|:            |.:|..::|...|    ||..   |..||.|..::..
  Rat   171 --LTVSTSPFVFEVPS------------KEKLVCWVVSNWN----PEHARVKYYNELSKSIEIHT 217

  Fly   302 HDNCLG--TDD------CSHYHFMLIFETSACPDYVPPQMSMAMDKLLVPVLIGGG--NLTNLVP 356
            :....|  .:|      .|...|.|.||.|...||:..::..|.....|||::|..  |..|.:|
  Rat   218 YGQAFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIP 282

  Fly   357 SHSYISSQDFATPQDLIIHLKDLANNQLEYRRYFWWHSIYRL---RKTSQPYCALCSLIQQSPGG 418
            :.|:|..:||.:|.:|..:||::..|...|..||.|...:.:   |......|..|.        
  Rat   283 ADSFIHVEDFNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACD-------- 339

  Fly   419 HEVRQRSY-SLGFINWW 434
            |..|.:.| |:|.:..|
  Rat   340 HVKRHQEYKSVGNLEKW 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTDNP_612107.1 Glyco_tran_10_N 125..228 CDD:293644 32/117 (27%)
Glyco_transf_10 268..427 CDD:279224 47/175 (27%)
Fut9NP_445917.1 Glyco_tran_10_N 62..169 CDD:407214 32/118 (27%)
Glyco_transf_10 185..354 CDD:395683 49/180 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336053
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2619
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394490at33208
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.