DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTD and Fut4

DIOPT Version :9

Sequence 1:NP_612107.1 Gene:FucTD / 38164 FlyBaseID:FBgn0035217 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_071555.3 Gene:Fut4 / 60670 RGDID:619954 Length:433 Species:Rattus norvegicus


Alignment Length:409 Identity:101/409 - (24%)
Similarity:140/409 - (34%) Gaps:138/409 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 ALKVMAVVLTICLVFTTIPLL-------RRQTMQESDNLRMILLWNEPSLVNAPAH----VEC-- 146
            |..::...||.||.:..:|.|       :|..        .:|||.|| ......|    .:|  
  Rat    59 AAGLLCTALTACLCWGQLPPLPWASPAPQRPV--------SVLLWWEP-FGGRGGHSKPPPDCSL 114

  Fly   147 -----GCLVTTSRSHNDKAFDAVVISADHPYSFEGLGGVKLHPDF-------------------- 186
                 ||.:.|.|:...:| .||:        |.....||..||:                    
  Rat   115 RFNISGCRLLTDRAAYGEA-QAVL--------FHHRDLVKGPPDWPPPWGAQERTDEAPELRVFD 170

  Fly   187 ---YAVYAAKKPLSST-QNP------LTNFTLPP------------FNLTMTYRLDSQLIWTDYY 229
               .||..|::.|.:| ..|      ..||..|.            ||.|::||.||. |:..|.
  Rat   171 DQEGAVMLAREALETTGSRPPGQRWVWMNFESPSHTPGLRGLAKDLFNWTLSYRTDSD-IFVPYG 234

  Fly   230 F----SHTNLARRLKWFRAPSKSFADDMPATTVLRLESEILKKSRLAVYLVYEVNEKTLPESLYM 290
            |    ||                     ||.....|...:.:|..|..::|...||:. ....|.
  Rat   235 FLYPRSH---------------------PAEQPSGLGPPLARKRGLVAWVVSHWNERQ-ARVRYY 277

  Fly   291 EELRKYADLDAHDNC-----------LGTDDCSHYHFMLIFETSACPDYVPPQMSMAMDKL---- 340
            .:||::..:|.....           |.|  .:.|.|.|.||.|...||:       .:||    
  Rat   278 HQLRRHVSVDVFGRAGPGQPVPAVGLLHT--VARYKFYLAFENSQHVDYI-------TEKLWRNA 333

  Fly   341 ----LVPVLIG--GGNLTNLVPSHSYISSQDFATPQDLIIHLKDLANNQLEYRRYFWWHSIYRLR 399
                .|||::|  ..|....||..|:|...||.:...|..:|..|..|...|||||.|...|.:.
  Rat   334 FLAGAVPVVLGPDRANYERFVPRGSFIHVDDFPSAASLAAYLLFLDRNVAVYRRYFHWRRSYAVH 398

  Fly   400 KTS---QPYCALCSLIQQS 415
            .||   :|:|..|..:|.|
  Rat   399 ITSFWDEPWCQTCRAVQTS 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTDNP_612107.1 Glyco_tran_10_N 125..228 CDD:293644 36/155 (23%)
Glyco_transf_10 268..427 CDD:279224 50/172 (29%)
Fut4NP_071555.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Glyco_tran_10_N 87..234 CDD:293644 37/165 (22%)
Glyco_transf_10 256..428 CDD:279224 50/172 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336054
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2619
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394490at33208
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.