DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTD and fut9

DIOPT Version :9

Sequence 1:NP_612107.1 Gene:FucTD / 38164 FlyBaseID:FBgn0035217 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_031757540.1 Gene:fut9 / 548391 XenbaseID:XB-GENE-966137 Length:368 Species:Xenopus tropicalis


Alignment Length:397 Identity:94/397 - (23%)
Similarity:150/397 - (37%) Gaps:111/397 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 ALKVMAVVLTICLVFTTIP--------------LLRRQ----TMQESDNLRMILLWNEP------ 135
            |:..:.:...|||:....|              :|:.:    :.|...|..::|:|..|      
 Frog    23 AVSGVLICFMICLLIYVKPTNNWISSPIESAHSVLKMKNFFSSKQNYYNETVVLIWVWPFGQTFE 87

  Fly   136 -----SLVNAPAHVECGCLVTTSRSHNDKAFDAVVISADHPYSFEGLGGVKLHPDFYAVYAAKKP 195
                 :|.|  .|   ||.:||.|:..:|:...::...|..:....| .::|.|.|      :|.
 Frog    88 LKSCQTLFN--IH---GCHLTTDRTLYNKSHAVLIHHRDISWDLTNL-PLQLRPPF------QKW 140

  Fly   196 L-----SSTQNPLTNFTLPPFNLTMTYRLDSQLIWTDYYFSHTNLARRLKWFRAPSKSFADDMPA 255
            :     |.|..|..:.....||||:|||.||. |...|.|...:           :|.|      
 Frog   141 IWMNLESPTHTPQKSGIEHLFNLTLTYRRDSD-IQVPYGFMVVS-----------TKPF------ 187

  Fly   256 TTVLRLESEILKKSRLAVYLVYEVNEKTLPESL---YMEELRKYADLDAHDNCLG---------- 307
                  |.|:..|.:...::|...|    ||..   |..||.||.::..:....|          
 Frog   188 ------EFEVPSKDKFVCWVVSNWN----PEHARVKYYNELNKYIEIITYGQAFGEYLSDKSLLP 242

  Fly   308 -TDDCSHYHFMLIFETSACPDYVPPQMSMAMDKLLVPVLIG--GGNLTNLVPSHSYISSQDFATP 369
             ...|..|   |.||.|...||:..::..|:....||:::|  ..|..|.:|:.|:|..:||.:|
 Frog   243 TISSCKFY---LSFENSIHKDYITEKLYNALLAGSVPIVLGPPRENYENYIPADSFIHVEDFLSP 304

  Fly   370 QDLIIHLKDLANNQLEYRRYFWWHSIYRLRKTSQPY------CALCSLIQQSPGGHEVRQRSY-S 427
            ::|..||..|..:..:|..||.|...:.:   |.|:      |..|.        |..|.:.| |
 Frog   305 RELSDHLLMLNKDTEQYLSYFNWRKHFTV---SMPHFWESHACLACD--------HVKRHQEYKS 358

  Fly   428 LGFINWW 434
            :|.:..|
 Frog   359 VGNLEKW 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTDNP_612107.1 Glyco_tran_10_N 125..228 CDD:293644 32/118 (27%)
Glyco_transf_10 268..427 CDD:279224 46/181 (25%)
fut9XP_031757540.1 Glyco_tran_10_N 71..178 CDD:407214 32/119 (27%)
Glyco_transf_10 194..363 CDD:395683 48/186 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394490at33208
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11929
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.