DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTD and Fut7

DIOPT Version :9

Sequence 1:NP_612107.1 Gene:FucTD / 38164 FlyBaseID:FBgn0035217 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_006233647.1 Gene:Fut7 / 296564 RGDID:735019 Length:380 Species:Rattus norvegicus


Alignment Length:321 Identity:77/321 - (23%)
Similarity:126/321 - (39%) Gaps:86/321 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 ILLWNEPSLVNAP--------AHVECGCLVTTSRSHNDKAFDAVV-----ISADH---------- 170
            ||:|:.|....:|        .:....|.::.:||....| ||||     :...|          
  Rat    87 ILIWHWPFTNRSPELSSDTCTRYGMASCHLSANRSLLASA-DAVVFHHRELQTRHSRLPLDQRPH 150

  Fly   171 --PYSFEGLGGVKLHPDFYAVYAAKKPLSSTQNPLTNFTLPPFNLTMTYRLDSQLIWTDYYFSHT 233
              |:                |:|..:..|:|.. |.:|. ..||..::||.||. |:..|     
  Rat   151 GQPW----------------VWATMESPSNTHG-LRHFR-GIFNWVLSYRRDSD-IFVPY----- 191

  Fly   234 NLARRLKWFRAPSKSFADDMPATTVLRLESEILKKSRLAVYLVYEVNEKTLPESLYMEELRKYAD 298
               .||:.|..|:    ..:||            |||:|.::|....|:.....|| .:|..:..
  Rat   192 ---GRLEPFSGPT----PPLPA------------KSRMAAWVVSNFQERQQRAKLY-RQLAPHLK 236

  Fly   299 LDAHDNCLGTDDC--------SHYHFMLIFETSACPDYVPPQM-SMAMDKLLVPVLIGGGNLT-- 352
            :|......|...|        :.|.|.|.||.|...||:..:. ..|:....|||::|....|  
  Rat   237 VDVFGRASGRPLCPNCLLPTVARYRFYLSFENSQHRDYITEKFWRNALAAGAVPVVLGPPRTTYE 301

  Fly   353 NLVPSHSYISSQDFATPQDLIIHLKDLANNQLEYRRYFWWHSIYRLRKTS---QPYCALCS 410
            ..||..::|...||::.::|.:.|  ::.|:..||.:|.|....|:|..:   :.:|.:|:
  Rat   302 AFVPPDAFIHVDDFSSARELAVFL--VSMNESRYRGFFAWRDRLRVRLLNDWRERFCTICA 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTDNP_612107.1 Glyco_tran_10_N 125..228 CDD:293644 28/123 (23%)
Glyco_transf_10 268..427 CDD:279224 42/157 (27%)
Fut7XP_006233647.1 Glyco_tran_10_N 82..192 CDD:293644 29/132 (22%)
Glyco_transf_10 207..375 CDD:279224 42/157 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336052
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2619
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394490at33208
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.