DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTD and Fut11

DIOPT Version :9

Sequence 1:NP_612107.1 Gene:FucTD / 38164 FlyBaseID:FBgn0035217 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_775430.2 Gene:Fut11 / 286971 RGDID:628731 Length:494 Species:Rattus norvegicus


Alignment Length:340 Identity:79/340 - (23%)
Similarity:122/340 - (35%) Gaps:108/340 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 ILLWNEPSLV-NAPA---HVEC---GCLVTTS-RSHNDKAFDAVVI------SADHPYSFEGLGG 179
            :|||..|.|. :.|.   .:||   .|:.:.. |:..|....|::.      :||.|..      
  Rat    78 VLLWWSPGLFPHFPGDSERIECALGACVASRDRRARADPRTRALLFYGTDFRAADAPLP------ 136

  Fly   180 VKLHPDFYAVYAAKKPLSSTQNPLTNFTLPP------FNLTMTYRLDSQLIWTDYYFSHTNLARR 238
             :|....:|       |...::||.||.|..      ||||.|:.            .|::....
  Rat   137 -RLAHQSWA-------LLHEESPLNNFLLSHGPGIRLFNLTATFS------------RHSDYPLP 181

  Fly   239 LKWFRAPSKSFADDMPATTVLRLESEILK-----KSRLAVYLVYEVNEKTLP--ESLYMEELRKY 296
            |:|           :|....||..:..|:     :.|....|:|..:...:|  ...|:.||.:|
  Rat   182 LQW-----------LPGAAYLRRPAPPLRERAEWRRRGYAPLLYLQSHCDVPSDRDRYVRELMRY 235

  Fly   297 ADLDAHDNCL----------------GTDD------CSHYHFMLIFETSACPDYVPPQMSMAMDK 339
            ..:|::..||                .|:|      .|.|.|.|..|.:.|.||:..::...|..
  Rat   236 IPVDSYGKCLQNREPPTVRLQDTATATTEDPELMAFLSRYKFHLAMENAICNDYMTEKLWRPMHL 300

  Fly   340 LLVPVLIGGGNLTNLVP-SHSYISSQDFATPQDLIIHLKDLANNQLEYRRYFWWHSIYRLRKTSQ 403
            ..|||..|..::.:.:| :||.|...||.:||.|...:..|..|..||.:|              
  Rat   301 GAVPVYRGSPSVRDWMPNNHSVILIDDFESPQKLAEFIDFLDKNDEEYMKY-------------- 351

  Fly   404 PYCALCSLIQQSPGG 418
                   |..:.|||
  Rat   352 -------LAYKQPGG 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTDNP_612107.1 Glyco_tran_10_N 125..228 CDD:293644 28/118 (24%)
Glyco_transf_10 268..427 CDD:279224 44/176 (25%)
Fut11NP_775430.2 Glyco_tran_10_N <120..181 CDD:293644 18/86 (21%)
Glyco_transf_10 217..356 CDD:279224 38/159 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336051
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2619
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D551308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.