DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTD and FUT7

DIOPT Version :9

Sequence 1:NP_612107.1 Gene:FucTD / 38164 FlyBaseID:FBgn0035217 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_004470.1 Gene:FUT7 / 2529 HGNCID:4018 Length:342 Species:Homo sapiens


Alignment Length:222 Identity:58/222 - (26%)
Similarity:93/222 - (41%) Gaps:46/222 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 FNLTMTYRLDSQLIWTDYYFSHTNLARRLK--WFRAPSKSFADDMPATTVLRLESEILKKSRLAV 273
            ||..::||.||. |:..|        .||:  |..:|      .:||            |||:|.
Human   137 FNWVLSYRRDSD-IFVPY--------G
RLEPHWGPSP------PLPA------------KSRVAA 174

  Fly   274 YLVYEVNEKTLPESLYMEELRKYADLDAHDNCLGTDDC--------SHYHFMLIFETSACPDYVP 330
            ::|....|:.|...|| .:|..:..:|......|...|        :.|.|.|.||.|...||:.
Human   175 WVVSNFQERQLRARLY-RQLAPHLRVDVFGRANGRPLCASCLVPTVAQYRFYLSFENSQHRDYIT 238

  Fly   331 PQM-SMAMDKLLVPVLIGGGNLT--NLVPSHSYISSQDFATPQDLIIHLKDLANNQLEYRRYFWW 392
            .:. ..|:....|||::|....|  ..||:.:::...||.:.::|...|..:  |:..|:|:|.|
Human   239 EKFWRNALVAGTVPVVLGPPRATYEAFVPADAFVHVDDFGSARELAAFLTGM--NESRYQRFFAW 301

  Fly   393 HSIYRLRKTS---QPYCALCSLIQQSP 416
            ....|:|..:   :.:||:|......|
Human   302 RDRLRVRLFTDWRERFCAICDRYPHLP 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTDNP_612107.1 Glyco_tran_10_N 125..228 CDD:293644 7/16 (44%)
Glyco_transf_10 268..427 CDD:279224 44/163 (27%)
FUT7NP_004470.1 Glyco_tran_10_N 44..154 CDD:319100 8/25 (32%)
Glyco_transf_10 169..337 CDD:307136 44/163 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142550
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2619
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394490at33208
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.