DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTD and FUT5

DIOPT Version :9

Sequence 1:NP_612107.1 Gene:FucTD / 38164 FlyBaseID:FBgn0035217 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_002025.2 Gene:FUT5 / 2527 HGNCID:4016 Length:374 Species:Homo sapiens


Alignment Length:361 Identity:95/361 - (26%)
Similarity:132/361 - (36%) Gaps:116/361 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 MILLWNEPSLVNAP-AHVECG--------CLVTTSRSHNDKAFDAVVISADHPYSFEGLGGVKLH 183
            :||||..|  .|.| |...|.        |.:|...|...:| |||::.               |
Human    77 LILLWTWP--FNTPVALPRCSEMVPGAADCNITADSSVYPQA-DAVIVH---------------H 123

  Fly   184 PDFYAVYAAKKPLSSTQNPLTNFTLPP-----------------------------FNLTMTYRL 219
            .|.  :|          ||..|  |||                             |||||:||.
Human   124 WDI--MY----------NPSAN--LPPPTRPQGQRWIWFSMESPSNCRHLEALDGYFNLTMSYRS 174

  Fly   220 DSQLIWTDYYFSHTNLARRLKWFRAPSKSFADDMPATTVLRLESEILKKSRLAVYLVYEVNEKTL 284
            ||. |:|.|           .|....|     ..||...|.|.:    |:.|..:.|  .|.|  
Human   175 DSD-IFTPY-----------G
WLEPWS-----GQPAHPPLNLSA----KTELVAWAV--SNWK-- 214

  Fly   285 PESL---YMEELRKYADLDAHDNC-----LGT--DDCSHYHFMLIFETSACPDYVPPQM-SMAMD 338
            |:|.   |.:.|:.:..:|.:...     .||  :..|.|.|.|.||.|..|||:..:: ..|::
Human   215 PDSARVRYYQSLQAHLKVDVYGRSHKPLPKGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALE 279

  Fly   339 KLLVPVLIG--GGNLTNLVPSHSYISSQDFATPQDLIIHLKDLANNQLEYRRYFWWHSIYRLRKT 401
            ...|||::|  ..|....:|..::|...||.:|:||..:|::|..:...|..||.|....|.|..
Human   280 AWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFHWRETLRPRSF 344

  Fly   402 S--QPYCALCSLIQQSPGGHEVRQRSYSLGFINWWT 435
            |  ..:|..|..:||......||      ....|:|
Human   345 SWALAFCKACWKLQQESRYQTVR------SIAAWFT 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTDNP_612107.1 Glyco_tran_10_N 125..228 CDD:293644 36/137 (26%)
Glyco_transf_10 268..427 CDD:279224 50/173 (29%)
FUT5NP_002025.2 Glyco_tran_10_N 73..183 CDD:293644 37/149 (25%)
Glyco_transf_10 202..370 CDD:279224 50/177 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142551
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2619
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394490at33208
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.