DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTD and FUT3

DIOPT Version :9

Sequence 1:NP_612107.1 Gene:FucTD / 38164 FlyBaseID:FBgn0035217 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_000140.1 Gene:FUT3 / 2525 HGNCID:4014 Length:361 Species:Homo sapiens


Alignment Length:394 Identity:99/394 - (25%)
Similarity:150/394 - (38%) Gaps:96/394 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 QCMNALKVMAVVLTICLVFTTIPLLR--------------RQTMQESDNLRMILLWNEPSLVNAP 141
            :|:.|| :..:::.:|. |:.:.:.|              ||....:....:||||..|..:.. 
Human    15 RCLAAL-LFQLLVAVCF-FSYLRVSRDDATGSPRAPSGSSRQDTTPTRPTLLILLWTWPFHIPV- 76

  Fly   142 AHVECG--------CLVTTSRSHNDKAFDAVVISADHPYSFEGLGGVKLHPDFYAVYAAKKPLSS 198
            |...|.        |.:|..|....:| |.|::   |.:........:|.|         .|...
Human    77 ALSRCSEMVPGTADCHITADRKVYPQA-DTVIV---HHWDIMSNPKSRLPP---------SPRPQ 128

  Fly   199 TQNPL-TNFTLPP-----------FNLTMTYRLDSQLIWTDYYFSHTNLARRLKWFRAPSKSFAD 251
            .|..: .|...||           |||||:||.||. |:|.|           .|....|     
Human   129 GQRWIWFNLEPPPNCQHLEALDRYFNLTMSYRSDSD-IFTPY-----------GWLEPWS----- 176

  Fly   252 DMPATTVLRLESEILKKSRLAVYLVYEVNEKTLPESL---YMEELRKYADLDAHDNC-----LGT 308
            ..||...|.|.:    |:.|..:.|  .|.|  |:|.   |.:.|:.:..:|.:...     .||
Human   177 GQPAHPPLNLSA----KTELVAWAV--SNWK--PDSARVRYYQSLQAHLKVDVYGRSHKPLPKGT 233

  Fly   309 --DDCSHYHFMLIFETSACPDYVPPQM-SMAMDKLLVPVLIG--GGNLTNLVPSHSYISSQDFAT 368
              :..|.|.|.|.||.|..|||:..:: ..|::...|||::|  ..|....:|..::|...||.:
Human   234 MMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQS 298

  Fly   369 PQDLIIHLKDLANNQLEYRRYFWWHSIYRLRKTS--QPYCALCSLIQQSPGGHEVRQRSYSLGFI 431
            |:||..:|::|..:...|..||.|....|.|..|  ..:|..|..:||......||      ...
Human   299 PKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALDFCKACWKLQQESRYQTVR------SIA 357

  Fly   432 NWWT 435
            .|:|
Human   358 AWFT 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTDNP_612107.1 Glyco_tran_10_N 125..228 CDD:293644 32/122 (26%)
Glyco_transf_10 268..427 CDD:279224 50/173 (29%)
FUT3NP_000140.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..58 2/18 (11%)
Glyco_tran_10_N 60..170 CDD:407214 33/135 (24%)
Glyco_transf_10 189..357 CDD:395683 50/177 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142552
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2619
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394490at33208
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.