DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTD and FUT11

DIOPT Version :9

Sequence 1:NP_612107.1 Gene:FucTD / 38164 FlyBaseID:FBgn0035217 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_775811.2 Gene:FUT11 / 170384 HGNCID:19233 Length:492 Species:Homo sapiens


Alignment Length:384 Identity:88/384 - (22%)
Similarity:137/384 - (35%) Gaps:121/384 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 RQTMQESDNLRMILLWNE---PSLVNAPAHVEC---GCLVTTSRSHNDKAFDAVVISADHPYSFE 175
            |...:|:.:|.::|.|:.   |........:||   .|:.:.:|.       |:..|......|.
Human    66 RPGREEAGDLPVLLWWSPGLFPHFPGDSERIECARGACVASRNRR-------ALRDSRTRALLFY 123

  Fly   176 GLGGVKLHPDFYAVYAAKKP--------LSSTQNPLTNFTLPP------FNLTMTYRLDSQLIWT 226
            |       .||.| .||..|        |...::||.||.|..      ||||.|:...|     
Human   124 G-------TDFRA-SAAPLPRLAHQSWALLHEESPLNNFLLSHGPGIRLFNLTSTFSRHS----- 175

  Fly   227 DYYFSHTNLARRLKWFRAPSKSFADDMPATTVLR------LESEILKKSRLAVYLVYEVNEKTLP 285
            ||..|       |:|           :|.|..||      :|....::...|. |:|..:...:|
Human   176 DYPLS-------LQW-----------LPGTAYLRRPVPPPMERAEWRRRGYAP-LLYLQSHCDVP 221

  Fly   286 --ESLYMEELRKYADLDAHDNCL----------------GTDD------CSHYHFMLIFETSACP 326
              ...|:.||.::..:|::..||                .|:|      .|.|.|.|..|.:.|.
Human   222 ADRDRYVRELMRHIPVDSYGKCLQNRELPTARLQDTATATTEDPELLAFLSRYKFHLALENAICN 286

  Fly   327 DYVPPQMSMAMDKLLVPVLIGGGNLTNLVP-SHSYISSQDFATPQDLIIHLKDLANNQLEYRRYF 390
            ||:..::...|....|||..|..::.:.:| :||.|...||.:||.|...:..|..|..||.:| 
Human   287 DYMTEKLWRPMHLGAVPVYRGSPSVRDWMPNNHSVILIDDFESPQKLAEFIDFLDKNDEEYMKY- 350

  Fly   391 WWHSIYRLRKTSQPYCALCSLIQQSPGG-------HEVRQRSYSLG---FINWWTKYQC 439
                                |..:.|||       ..::.|.:.:.   ..|:...::|
Human   351 --------------------LAYKQPGGITNQFLLDSLKHREWGVNDPLLPNYLNGFEC 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTDNP_612107.1 Glyco_tran_10_N 125..228 CDD:293644 30/122 (25%)
Glyco_transf_10 268..427 CDD:279224 44/190 (23%)
FUT11NP_775811.2 Glyco_tran_10_N 77..176 CDD:293644 29/118 (25%)
Glyco_transf_10 216..355 CDD:279224 37/159 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142549
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2619
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D551308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.