DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTD and Fut9

DIOPT Version :9

Sequence 1:NP_612107.1 Gene:FucTD / 38164 FlyBaseID:FBgn0035217 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_034373.1 Gene:Fut9 / 14348 MGIID:1330859 Length:359 Species:Mus musculus


Alignment Length:383 Identity:93/383 - (24%)
Similarity:144/383 - (37%) Gaps:97/383 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LYSPIQCMNALKVMAVVLTICLVFTTIPLLRRQTMQESD--NLRMILLWNEP-----SLVNAPAH 143
            ::||::..::      ||.:...|:|          ::|  |...||:|..|     .|.:..|.
Mouse    37 VFSPMESASS------VLKMKNFFST----------KTDYFNETTILVWVWPFGQTFDLTSCQAM 85

  Fly   144 VEC-GCLVTTSRSHNDKAFDAVVISADHPYSFEGLGGVKLHPDFYAVYAAKKPL---------SS 198
            ... ||.:||.||..:|:...::...|..:....|      |.     .|:.|.         |.
Mouse    86 FNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNL------PQ-----QARPPFQKWIWMNLESP 139

  Fly   199 TQNPLTNFTLPPFNLTMTYRLDSQLIWTDYYFSHTNLARRLKWFRAPSKSFADDMPATTVLRLES 263
            |..|..:.....||||:|||.||. |...|.|           ....:..|..::|:        
Mouse   140 THTPQKSGIEHLFNLTLTYRRDSD-IQVPYGF-----------LTVSTNPFVFEVPS-------- 184

  Fly   264 EILKKSRLAVYLVYEVNEKTLPESL---YMEELRKYADLDAHDNCLG--TDD------CSHYHFM 317
                |.:|..::|...|    ||..   |..||.|..::..:....|  .:|      .|...|.
Mouse   185 ----KEKLVCWVVSNWN----PEHARVKYYNELSKSIEIHTYGQAFGEYVNDKNLIPTISTCKFY 241

  Fly   318 LIFETSACPDYVPPQMSMAMDKLLVPVLIGGG--NLTNLVPSHSYISSQDFATPQDLIIHLKDLA 380
            |.||.|...||:..::..|.....|||::|..  |..|.:|:.|:|..:||.:|.:|..:||::.
Mouse   242 LSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDFNSPSELAKYLKEVD 306

  Fly   381 NNQLEYRRYFWWHSIYRL---RKTSQPYCALCSLIQQSPGGHEVRQRSY-SLGFINWW 434
            .|...|..||.|...:.:   |......|..|.        |..|.:.| |:|.:..|
Mouse   307 KNNKLYLSYFNWRKDFTVNLPRFWESHACLACD--------HVKRHQEYKSVGNLEKW 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTDNP_612107.1 Glyco_tran_10_N 125..228 CDD:293644 32/117 (27%)
Glyco_transf_10 268..427 CDD:279224 47/175 (27%)
Fut9NP_034373.1 Glyco_tran_10_N 62..169 CDD:293644 32/118 (27%)
Glyco_transf_10 185..354 CDD:279224 49/180 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832401
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2619
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394490at33208
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.