DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTD and Fut7

DIOPT Version :9

Sequence 1:NP_612107.1 Gene:FucTD / 38164 FlyBaseID:FBgn0035217 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_011237324.1 Gene:Fut7 / 14347 MGIID:107692 Length:438 Species:Mus musculus


Alignment Length:306 Identity:75/306 - (24%)
Similarity:125/306 - (40%) Gaps:56/306 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 ILLWNEPSLVNAPAHVE---------CGCLVTTSRSHNDKAFDAVVISADHPYSFEGLGGVKLHP 184
            ||:|:.| ..|.|..:.         ..|.::.:||....| ||||.......:.:.|..:...|
Mouse   145 ILIWHWP-FTNRPPELPGDTCTRYGMASCRLSANRSLLASA-DAVVFHHRELQTRQSLLPLDQRP 207

  Fly   185 DFYA-VYAAKKPLSSTQNPLTNFTLPPFNLTMTYRLDSQLIWTDYYFSHTNLARRLKWFRAPSKS 248
            .... |:|:.:..|:|.. |..|. ..||..::||.||. |:..|        .||:....|:  
Mouse   208 HGQPWVWASMESPSNTHG-LHRFR-GIFNWVLSYRRDSD-IFVPY--------GRLEPLSGPT-- 259

  Fly   249 FADDMPATTVLRLESEILKKSRLAVYLVYEVNEKTLPESLYMEELRKYADLDAHDNCLGTDDCSH 313
              ..:||            |||:|.:::....|:.....|| .:|..:..:|......|...|::
Mouse   260 --SPLPA------------KSRMAAWVISNFQERQQRAKLY-RQLAPHLQVDVFGRASGRPLCAN 309

  Fly   314 --------YHFMLIFETSACPDYVPPQM-SMAMDKLLVPVLIGGGNLT--NLVPSHSYISSQDFA 367
                    |.|.|.||.|...||:..:. ..|:....|||.:|....|  ..||..:::...||:
Mouse   310 CLLPTLARYRFYLAFENSQHRDYITEKFWRNALAAGAVPVALGPPRATYEAFVPPDAFVHVDDFS 374

  Fly   368 TPQDLIIHLKDLANNQLEYRRYFWWHSIYRLRKTS---QPYCALCS 410
            :.::|.:.|  ::.|:..||.:|.|....|:|...   :.:|.:|:
Mouse   375 SARELAVFL--VSMNESRYRGFFAWRDRLRVRLLGDWRERFCTICA 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTDNP_612107.1 Glyco_tran_10_N 125..228 CDD:293644 29/108 (27%)
Glyco_transf_10 268..427 CDD:279224 40/157 (25%)
Fut7XP_011237324.1 Glyco_tran_10_N 140..250 CDD:374959 30/117 (26%)
Glyco_transf_10 265..433 CDD:366335 40/157 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832400
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2619
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.