DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTD and FUT9

DIOPT Version :9

Sequence 1:NP_612107.1 Gene:FucTD / 38164 FlyBaseID:FBgn0035217 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_006572.2 Gene:FUT9 / 10690 HGNCID:4020 Length:359 Species:Homo sapiens


Alignment Length:383 Identity:92/383 - (24%)
Similarity:144/383 - (37%) Gaps:97/383 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LYSPIQCMNALKVMAVVLTICLVFTTIPLLRRQTMQESD--NLRMILLWNEP-----SLVNAPAH 143
            ::||::..::      ||.:...|:|          ::|  |...||:|..|     .|.:..|.
Human    37 IFSPMESASS------VLKMKNFFST----------KTDYFNETTILVWVWPFGQTFDLTSCQAM 85

  Fly   144 VEC-GCLVTTSRSHNDKAFDAVVISADHPYSFEGLGGVKLHPDFYAVYAAKKPL---------SS 198
            ... ||.:||.||..:|:...::...|..:....|      |.     .|:.|.         |.
Human    86 FNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNL------PQ-----QARPPFQKWIWMNLESP 139

  Fly   199 TQNPLTNFTLPPFNLTMTYRLDSQLIWTDYYFSHTNLARRLKWFRAPSKSFADDMPATTVLRLES 263
            |..|..:.....||||:|||.||. |...|.|           ....:..|..::|:        
Human   140 THTPQKSGIEHLFNLTLTYRRDSD-IQVPYGF-----------LTVSTNPFVFEVPS-------- 184

  Fly   264 EILKKSRLAVYLVYEVNEKTLPESL---YMEELRKYADLDAHDNCLG--TDD------CSHYHFM 317
                |.:|..::|...|    ||..   |..||.|..::..:....|  .:|      .|...|.
Human   185 ----KEKLVCWVVSNWN----PEHARVKYYNELSKSIEIHTYGQAFGEYVNDKNLIPTISTCKFY 241

  Fly   318 LIFETSACPDYVPPQMSMAMDKLLVPVLIGGG--NLTNLVPSHSYISSQDFATPQDLIIHLKDLA 380
            |.||.|...||:..::..|.....|||::|..  |..|.:|:.|:|..:|:.:|.:|..:||::.
Human   242 LSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAKYLKEVD 306

  Fly   381 NNQLEYRRYFWWHSIYRL---RKTSQPYCALCSLIQQSPGGHEVRQRSY-SLGFINWW 434
            .|...|..||.|...:.:   |......|..|.        |..|.:.| |:|.:..|
Human   307 KNNKLYLSYFNWRKDFTVNLPRFWESHACLACD--------HVKRHQEYKSVGNLEKW 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTDNP_612107.1 Glyco_tran_10_N 125..228 CDD:293644 32/117 (27%)
Glyco_transf_10 268..427 CDD:279224 46/175 (26%)
FUT9NP_006572.2 Glyco_tran_10_N 62..169 CDD:407214 32/118 (27%)
Glyco_transf_10 185..354 CDD:395683 48/180 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142554
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2619
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394490at33208
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.