DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTD and zgc:165582

DIOPT Version :9

Sequence 1:NP_612107.1 Gene:FucTD / 38164 FlyBaseID:FBgn0035217 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001096106.1 Gene:zgc:165582 / 100124609 ZFINID:ZDB-GENE-070820-9 Length:364 Species:Danio rerio


Alignment Length:404 Identity:88/404 - (21%)
Similarity:158/404 - (39%) Gaps:90/404 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 PRRSPVSMRNLQRELYSPIQCMNALKVMAVVLTICLVF--------------TTIPLLRRQTMQE 122
            |.:.|.:       .::||.   ....::|.|.|.||:              ||...|:.:.:  
Zfish     2 PNQEPTA-------AFNPIY---LFLFISVGLNIFLVYSGYLSPDYNTLSYTTTCTTLKEKPL-- 54

  Fly   123 SDNLRMILLWNEP-------SLVNAPAHVECGCLVTTSRSHNDKAFDAVVISADHPYSFEGLGGV 180
             :|..::|:|..|       :..:|..::: ||.:|..|...|.|...::...|.......| ..
Zfish    55 -ENSTILLIWIWPFGKKFDLNSCSAKFNID-GCHLTVGRELYDDAHGVLINHRDIKNDLSNL-PT 116

  Fly   181 KLHPDFYA-VYAAKKPLSSTQ--NPLTNFTLPPFNLTMTYRLDSQLIWTDYYFSHTNLARRLKWF 242
            |..|.|.. ::...:...:|:  :.|.|.    ||:|:.||.|:.::..:.             |
Zfish   117 KPRPFFQKWIWMHFESPENTRRLDGLNNL----FNVTLNYRRDADIVLREQ-------------F 164

  Fly   243 RAPSKSFADDMPATTVLRLESEIL-KKSRLAVYLVYEVNEKTLPESLYMEELRKYADLDAHDNCL 306
            ...|:...|        ::..::| ||.:|..::|...||:. ....|..||:|:.::.|.....
Zfish   165 IIKSEDTED--------KIFPQVLDKKDKLVCWIVSNWNERH-ERVAYFNELKKHINIYALGRHF 220

  Fly   307 G--------TDDCSHYHFMLIFE-TSACPDYVPPQMSMAMDKLLVPVLIGGGN--LTNLVPSHSY 360
            |        .:..:...|.|.|| |:...||:..::...:....|||.:|...  ....||..::
Zfish   221 GKQLSDTQYKEALTRCKFYLSFENTNLHYDYITEKLFNPLTLGSVPVALGAPRYIYERFVPKDAF 285

  Fly   361 ISSQDFATPQDLIIHLKDLANNQLEYRRYFWWHSIYRLRKTSQP---YCALCSLIQQSPGGHEVR 422
            |..:||::||.|..||..|..|..||::||.|...:.::....|   .|..|..|:        .
Zfish   286 IHVKDFSSPQKLAEHLLALDKNVDEYKKYFQWRKHFEIKLVDYPEEHACRACQYIR--------A 342

  Fly   423 QRSYSL--GFINWW 434
            ::.|.:  ...||:
Zfish   343 KKDYQVFRNLNNWY 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTDNP_612107.1 Glyco_tran_10_N 125..228 CDD:293644 25/112 (22%)
Glyco_transf_10 268..427 CDD:279224 43/172 (25%)
zgc:165582NP_001096106.1 Glyco_tran_10_N 55..161 CDD:293644 25/111 (23%)
Glyco_transf_10 183..353 CDD:279224 44/178 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575270
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2619
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394490at33208
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.