DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTD and fut9b.5

DIOPT Version :9

Sequence 1:NP_612107.1 Gene:FucTD / 38164 FlyBaseID:FBgn0035217 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001092736.1 Gene:fut9b.5 / 100093713 ZFINID:ZDB-GENE-070620-12 Length:318 Species:Danio rerio


Alignment Length:317 Identity:70/317 - (22%)
Similarity:128/317 - (40%) Gaps:103/317 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 VMAVVLTICLVF----------TTIPLLRRQ---TMQESDNLR--------MILLWNEP------ 135
            |:|.::::.:::          :.:|.|:::   :.::||.|.        ::|||..|      
Zfish     2 VVAGLVSLTILYCSPSTPKNCPSPLPNLKQEESYSTKKSDALTNKIIEDKPILLLWFWPENYFFD 66

  Fly   136 -----SLVNAPAHVECGCLVTTSRSHNDKAFDAVV----ISADHPYSFEGLGGVKLHP----DFY 187
                 ::.|..     ||.:|.:|...:|:.:.::    ||.|       |..:...|    ..:
Zfish    67 FSDCKTIFNID-----GCQLTDNRLLYEKSDNVLIYHKAISWD-------LSNLPPSPRPLFQKW 119

  Fly   188 AVYAAKKPLSSTQNP-LTNFTLPPFNLTMTYRLDSQLIWTDYYFSHTNLARRLKWFRAPSKSFAD 251
            ..:..:.|.::.:.| |.|.    ||||::||.|..:          .:..|||..:.|:..|. 
Zfish   120 IWFNVESPTNTRKKPGLENL----FNLTLSYREDGDI----------PVRMRLKTRKTPADDFV- 169

  Fly   252 DMPATTVLRLESEILKKSRLAVYLVYEVNEKTL----PESLYMEELRKYADL----DAHDNCLGT 308
                         |.||.:|..::|  .|:.|.    ..:.|.|||||:.::    .|.:..|  
Zfish   170 -------------IPKKDKLVCWIV--SNKATYTGAGTRNKYYEELRKHINVTVFGKAFEKFL-- 217

  Fly   309 DDCSHYH-------FMLIFETSACPDYVPPQMSMAMDKLLVPVLIG--GGNLTNLVP 356
             |.:.|:       |.|.||.|...||:..:::..:....|||::|  ..|..|.||
Zfish   218 -DYNQYYPTLASCKFYLSFENSIHKDYITEKLNGPLAVGTVPVVLGPPRKNYENFVP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTDNP_612107.1 Glyco_tran_10_N 125..228 CDD:293644 27/130 (21%)
Glyco_transf_10 268..427 CDD:279224 30/106 (28%)
fut9b.5NP_001092736.1 Glyco_tran_10_N 49..155 CDD:293644 26/131 (20%)
Glyco_transf_10 173..>276 CDD:279224 30/106 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575267
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.