DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 312 and AT1G67620

DIOPT Version :9

Sequence 1:NP_001261254.1 Gene:312 / 38161 FlyBaseID:FBgn0029514 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_564901.1 Gene:AT1G67620 / 843083 AraportID:AT1G67620 Length:184 Species:Arabidopsis thaliana


Alignment Length:140 Identity:39/140 - (27%)
Similarity:66/140 - (47%) Gaps:14/140 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 GVFDVEDLVELLRKENV------DDIFVCYVPENLKYVDHLVVCSGRSYRHMLSTAEFV--RRMF 156
            |:.:|.:::.|...|.:      |::.|.....:..:.|..|:.:|||..|:.:.|:.:  |...
plant    37 GISNVSEILTLPEVEKILADVKADNVTVIPTHNHCFWADFTVIATGRSDWHLRNIAQALVYRAKQ 101

  Fly   157 KIKRGKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREEYDLESLW-AIGSEFDRESQKPTNP 220
            |.|..|..:||.::|..|: |:.:|.|...:|.....||..::||||| |..|..|...|...| 
plant   102 KQKGAKHVMLPSVQGYNSK-WIVIDYGKFVVHALDEKARGYFNLESLWSAESSGTDTSDQDLQN- 164

  Fly   221 YGDIFMAQTP 230
               :|:...|
plant   165 ---VFVKVRP 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
312NP_001261254.1 RsfS 105..204 CDD:280555 28/106 (26%)
AT1G67620NP_564901.1 RsfS 49..148 CDD:376779 27/99 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 49 1.000 Domainoid score I4457
eggNOG 1 0.900 - - E1_COG0799
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590818at2759
OrthoFinder 1 1.000 - - FOG0005796
OrthoInspector 1 1.000 - - oto3440
orthoMCL 1 0.900 - - OOG6_101813
Panther 1 1.100 - - LDO PTHR21043
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.