DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 312 and AT3G12930

DIOPT Version :9

Sequence 1:NP_001261254.1 Gene:312 / 38161 FlyBaseID:FBgn0029514 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_566439.1 Gene:AT3G12930 / 820478 AraportID:AT3G12930 Length:238 Species:Arabidopsis thaliana


Alignment Length:233 Identity:52/233 - (22%)
Similarity:87/233 - (37%) Gaps:58/233 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DRRLSVPVLRCFHHEFSK------PPQQAAKGQEIEGNPEKTLVAGVQDKYKIFRDEEATEIFD- 68
            :|.||.|...|:.....|      ..::.|.|:|.|            |.:.....|:..|:|| 
plant    40 NRDLSSPYNCCWRLSRGKILTSLSNSRKFAVGKEAE------------DGFLSNVSEDTDEMFDD 92

  Fly    69 ----VEEARHQEQQLPEPDLELDHYYGLNLKRGVRGVFDVEDL---VELLRKEN---VDDIFVCY 123
                ..:...:...:..|..|:|.              |.|.|   |||.:..:   ..||.|.:
plant    93 LFNKYGKVVFRSTDVKSPTAEVDD--------------DAESLAFAVELAKVASDVKAGDIKVLF 143

  Fly   124 VPENLKYVDHLVVCSGRSYRHMLSTAEFVRRMFKIKRGK---GDILPRIEGDKSRDWMAMDLGNI 185
            |...:.:....::.:..|...:.:....:|.:.:.|.||   ||:.|       ..|..:|.|::
plant   144 VKPLVYWTRFFIIATAFSRPQIDAIGSRMRDLAEKKYGKVANGDVKP-------NSWTLLDFGDV 201

  Fly   186 ALHIFSPSAREEYDLESLWA----IGSEFDRESQKPTN 219
            .:|:|.|..|..|:||..:.    |...|:.:|| |.|
plant   202 VIHLFLPPQRTFYNLEDFYGNAMQIELPFEDQSQ-PRN 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
312NP_001261254.1 RsfS 105..204 CDD:280555 27/107 (25%)
AT3G12930NP_566439.1 RsfS 126..220 CDD:280555 24/100 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0799
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590818at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101813
Panther 1 1.100 - - O PTHR21043
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.