DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 312 and Malsu1

DIOPT Version :9

Sequence 1:NP_001261254.1 Gene:312 / 38161 FlyBaseID:FBgn0029514 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_006506784.1 Gene:Malsu1 / 75593 MGIID:1922843 Length:282 Species:Mus musculus


Alignment Length:181 Identity:58/181 - (32%)
Similarity:91/181 - (50%) Gaps:28/181 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 EEATEIFDVEEARHQEQQLPEPDLELDHYYGLNLKRGVRGVFDVEDLVELLRKENVDDIFVCYVP 125
            ||.|    ..:||.|    |.|   .||         :...||::.||.|||:||..||.|..||
Mouse    65 EERT----AGDARLQ----PGP---ADH---------IGAKFDIDMLVSLLRQENARDICVIQVP 109

  Fly   126 ENLKYVDHLVVCSGRSYRHMLSTAEFVRRMFKIKRGKGDILPRIEGDKSRDWMAMDLGNIALHIF 190
            ..::|.|:.|:.||.|.||:.:...::.:|:|..:.:.|...:|||..:.||:.:|.|::.:|:.
Mouse   110 PEMRYTDYFVIGSGTSTRHLHAMVHYLVKMYKHLKCRSDPYVKIEGKDADDWLCVDFGSMVIHLM 174

  Fly   191 SPSAREEYDLESLWAIGSEFDRESQKPTNPYGDIFM--------AQTPLSF 233
            .|..||.|:||.||.:.|..|:.:|.......:.|:        :.||:.|
Mouse   175 LPETRETYELEKLWTLRSFDDQLAQIAAETLPEDFILGLEDDTSSLTPVEF 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
312NP_001261254.1 RsfS 105..204 CDD:280555 37/98 (38%)
Malsu1XP_006506784.1 RsfS 89..188 CDD:376779 37/98 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838350
Domainoid 1 1.000 88 1.000 Domainoid score I7941
eggNOG 1 0.900 - - E1_COG0799
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005796
OrthoInspector 1 1.000 - - oto93863
orthoMCL 1 0.900 - - OOG6_101813
Panther 1 1.100 - - LDO PTHR21043
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7333
SonicParanoid 1 1.000 - - X6277
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.