DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 312 and malsu1

DIOPT Version :9

Sequence 1:NP_001261254.1 Gene:312 / 38161 FlyBaseID:FBgn0029514 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001016140.1 Gene:malsu1 / 548894 XenbaseID:XB-GENE-1000345 Length:243 Species:Xenopus tropicalis


Alignment Length:114 Identity:49/114 - (42%)
Similarity:72/114 - (63%) Gaps:0/114 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 FDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLSTAEFVRRMFKIKRGKGDIL 166
            ||:..||.|||:||..|:.|..||..|||.|:.||.||.|.||:.:.|::..:::|..:.:.:..
 Frog   101 FDINTLVSLLRQENAKDLCVIRVPPQLKYTDYFVVVSGFSTRHVQAMAQYSVKVYKYLKREDEPH 165

  Fly   167 PRIEGDKSRDWMAMDLGNIALHIFSPSAREEYDLESLWAIGSEFDRESQ 215
            .:|||:.:.|||.:|.|||.:|...|..||:|:||.||.:.|..|:.||
 Frog   166 VQIEGEDTDDWMCIDFGNIVVHFMLPETREKYELEKLWTLRSYDDQLSQ 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
312NP_001261254.1 RsfS 105..204 CDD:280555 41/98 (42%)
malsu1NP_001016140.1 RsfS 104..203 CDD:376779 41/98 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7502
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590818at2759
OrthoFinder 1 1.000 - - FOG0005796
OrthoInspector 1 1.000 - - oto104084
Panther 1 1.100 - - LDO PTHR21043
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7333
SonicParanoid 1 1.000 - - X6277
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.050

Return to query results.
Submit another query.