DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 312 and Malsu1

DIOPT Version :9

Sequence 1:NP_001261254.1 Gene:312 / 38161 FlyBaseID:FBgn0029514 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001100063.1 Gene:Malsu1 / 297082 RGDID:1306936 Length:229 Species:Rattus norvegicus


Alignment Length:172 Identity:52/172 - (30%)
Similarity:87/172 - (50%) Gaps:22/172 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 QEQQLPEPDLEL-----DHYYGLNLKRGVRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHL 134
            |.::..|.|..|     ||         :...||::.||.||::||..||.|..||..::|.|:.
  Rat    64 QPEERTEGDARLQPGAADH---------IGAKFDIDMLVSLLKQENARDICVIKVPPEMRYTDYF 119

  Fly   135 VVCSGRSYRHMLSTAEFVRRMFKIKRGKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREEYD 199
            |:.||.|.||:.:...::.:.:|..:.:.|...:|||..:.||:.:|.|::.:|:..|..||.|:
  Rat   120 VIGSGTSTRHLHAMVHYIVKTYKHLKCRSDPYVKIEGKDTDDWLCVDFGSMVIHLMLPETRETYE 184

  Fly   200 LESLWAIGSEFDRESQKPTNPYGDIFM--------AQTPLSF 233
            ||.||.:.|..|:.:|.......:.|:        :.||:.|
  Rat   185 LEKLWTLRSFDDQLAQIAAETLPEDFILGLEDDTSSLTPMEF 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
312NP_001261254.1 RsfS 105..204 CDD:280555 35/98 (36%)
Malsu1NP_001100063.1 RsfS 90..189 CDD:396811 35/98 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342140
Domainoid 1 1.000 85 1.000 Domainoid score I8046
eggNOG 1 0.900 - - E1_COG0799
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590818at2759
OrthoFinder 1 1.000 - - FOG0005796
OrthoInspector 1 1.000 - - oto97401
orthoMCL 1 0.900 - - OOG6_101813
Panther 1 1.100 - - LDO PTHR21043
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6277
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.710

Return to query results.
Submit another query.