DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 312 and K12H4.2

DIOPT Version :9

Sequence 1:NP_001261254.1 Gene:312 / 38161 FlyBaseID:FBgn0029514 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_498757.2 Gene:K12H4.2 / 176135 WormBaseID:WBGene00019677 Length:190 Species:Caenorhabditis elegans


Alignment Length:224 Identity:57/224 - (25%)
Similarity:90/224 - (40%) Gaps:49/224 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQAAKGQEIEGNPEKTLVAGVQDKYKIFRDEEATE 65
            ||||..||       .|:|:.         :..|:...||            ::|  |.:.|.|.
 Worm     1 MLTRFTRL-------RPILQL---------RYLAQNSHIE------------EEY--FEELEPTG 35

  Fly    66 IFDVEEARHQEQQLPEPDLELDHYYGLNLKRGVRGVFD-VEDLVELLRKENVDDIFVCYVPE-NL 128
            |.    :.|:..|.|.   :...:...||....    | ||::|..|..:...|:||....| .:
 Worm    36 II----SSHETSQEPP---KRTGFRSQNLSEDA----DFVENVVGALTDQRAKDVFVVKSEETEM 89

  Fly   129 KYVDHLVVCSGRSYRHMLSTAEFVRRMFKIKRGKGDIL--PRIEGDKSRDWMAMDLGNIALHIFS 191
            ....|.::||..:.|...:.:|.:|.:.||.......:  .|....:|..|...::..:.:|:.|
 Worm    90 TPYTHKIICSAFNSRQASAISENLRSLLKIDGVSNGSMSHARRSTKRSNGWYVSEVERVQVHVMS 154

  Fly   192 PSAREEYDLESLWA----IGSEFDRESQK 216
            ...||:||||::||    |..|.|.|.||
 Worm   155 EECREKYDLEAIWAGDDRILDEIDEEKQK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
312NP_001261254.1 RsfS 105..204 CDD:280555 26/101 (26%)
K12H4.2NP_498757.2 RsfS 65..167 CDD:280555 26/101 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I8209
eggNOG 1 0.900 - - E1_COG0799
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590818at2759
OrthoFinder 1 1.000 - - FOG0005796
OrthoInspector 1 1.000 - - oto18655
orthoMCL 1 0.900 - - OOG6_101813
Panther 1 1.100 - - LDO PTHR21043
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7333
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.810

Return to query results.
Submit another query.