Sequence 1: | NP_476687.1 | Gene: | Ptp61F / 38160 | FlyBaseID: | FBgn0267487 | Length: | 548 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_014851.3 | Gene: | PTP2 / 854383 | SGDID: | S000005734 | Length: | 750 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 338 | Identity: | 82/338 - (24%) |
---|---|---|---|
Similarity: | 129/338 - (38%) | Gaps: | 121/338 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 NRYRDVNPYDHSRIVL------------------------------KRGSV---DYINANLVQLE 95
Fly 96 R--AERQYILTQGPLVDTVGHFWLMVWEQKSRAVLMLNKLMEKKQIKCHLYWPNEMGADKALKLP 158
Fly 159 HVKLTVELVRLETYQNF------VRRWFK----------------------LTDLETQQSRE--V 193
Fly 194 MQFHYTTWPD-FGIPSSPNAFLKFLQQVRDS---------GCLSRDV------------------ 230
Fly 231 --GPAVVHCSAGIGRSGTFCLVDCCLVLI-------DKYGECNVSK-----VLCELRSYRMGLIQ 281
Fly 282 TADQLDFSYQAII 294 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ptp61F | NP_476687.1 | PTPc | 34..295 | CDD:214550 | 82/338 (24%) |
PTPc | 62..295 | CDD:238006 | 82/338 (24%) | ||
PTP2 | NP_014851.3 | COG5599 | 344..748 | CDD:227886 | 82/338 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0789 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |