DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp61F and PTPN5

DIOPT Version :10

Sequence 1:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster
Sequence 2:XP_016873923.1 Gene:PTPN5 / 84867 HGNCID:9657 Length:719 Species:Homo sapiens


Alignment Length:117 Identity:43/117 - (36%)
Similarity:64/117 - (54%) Gaps:13/117 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 NRYRDVNPYDHSRIVLKRGSVD-----YINANLVQ-LERAERQYILTQGPLVDTVGHFWLMVWEQ 122
            |||:.:.|..|||:.|.....|     |||||.:: ....|:.||.||||:|.||..||.|||::
Human   326 NRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQE 390

  Fly   123 KSRAVLMLNKLMEKKQIKCHLYWPNEMGADKALKLPHVKLTVE-LVRLETYQ 173
            .:..::|:..:.|..: ||..|||.|..|     ...|::||: ::..|.|:
Human   391 HTPIIVMITNIEEMNE-KCTEYWPEEQVA-----YDGVEITVQKVIHTEDYR 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp61FNP_476687.1 PTPc-N1_2 63..291 CDD:350393 43/117 (37%)
PTPN5XP_016873923.1 PTP_DSP_cys 298..>453 CDD:475123 43/117 (37%)
PHA03247 <477..686 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.