DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp61F and PTPN9

DIOPT Version :9

Sequence 1:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_002824.1 Gene:PTPN9 / 5780 HGNCID:9661 Length:593 Species:Homo sapiens


Alignment Length:281 Identity:104/281 - (37%)
Similarity:153/281 - (54%) Gaps:22/281 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YKEICETCDREAKEKQFSTSESERHTNRGLNRYRDVNPYDHSRIVLKRGS----VDYINANLVQL 94
            |:|. |...||.....|..|.|..:..:  |||.||...|.:|:.|.:.|    .|||||:.:..
Human   304 YEEY-EDIRRENPVGTFHCSMSPGNLEK--NRYGDVPCLDQTRVKLTKRSGHTQTDYINASFMDG 365

  Fly    95 ERAERQYILTQGPLVDTVGHFWLMVWEQKSRAVLMLNKLMEKKQIKCHLYWPNEMGADKALKLPH 159
            .:.:..||.|||||.:|...|||||||||...::|..:..|..:.||..|||.|    |..::..
Human   366 YKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWPLE----KDSRIRF 426

  Fly   160 VKLTVELVRLETYQNFVRRWFKLTDLETQQSREVMQFHYTTWPDFGIPSSPNAFLKFLQQVRDSG 224
            ..|||..:.:|...::.:...::.:.|.:|.|:|..|.:.:|||:|:|||..:.:.||:.||:..
Human   427 GFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASLIDFLRVVRNQQ 491

  Fly   225 CL------SRDVG-----PAVVHCSAGIGRSGTFCLVDCCLVLIDKYGECNVSKVLCELRSYRMG 278
            .|      :|..|     |.||||||||||:||||.:|.||..:::.|..||.:.:..:|:.|..
Human   492 SLAVSNMGARSKGQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGTLNVFQTVSRMRTQRAF 556

  Fly   279 LIQTADQLDFSYQAIIEGIKK 299
            .|||.:|..|.|:||:|..:|
Human   557 SIQTPEQYYFCYKAILEFAEK 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 102/275 (37%)
PTPc 62..295 CDD:238006 94/247 (38%)
PTPN9NP_002824.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
CRAL_TRIO_N 20..68 CDD:215024
SEC14 90..240 CDD:214706
PTPc-N9 299..569 CDD:350391 99/271 (37%)
Substrate binding. /evidence=ECO:0000250 515..521 5/5 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000704
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.