DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp61F and PTPN7

DIOPT Version :9

Sequence 1:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster
Sequence 2:XP_011508121.1 Gene:PTPN7 / 5778 HGNCID:9659 Length:511 Species:Homo sapiens


Alignment Length:323 Identity:91/323 - (28%)
Similarity:130/323 - (40%) Gaps:106/323 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 HTNRGLNRYRDVNPYDHSRIVLKRGSV----DYINANLVQ-LERAERQYILTQGPLVDTVGHFWL 117
            |.::  :||:.:.|...||:.|.|...    ||||||.:: .:..|:.||.||||:.:||..||.
Human   224 HASK--DRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWE 286

  Fly   118 MVWEQKSRAVLMLNKLMEKKQIKCHLYWPNEMGADKALKLPHVKLTVELVRLETYQNF------- 175
            |||:::...::||.:|.|.|: ||..|||.|.                    |||..|       
Human   287 MVWQEEVSLIVMLTQLREGKE-KCVHYWPTEE--------------------ETYGPFQIRIQDM 330

  Fly   176 -------VRRWFKLTDLETQQSREVMQFHYTTWPDFGIPSSPNAFLKFLQQVRDSGCLSRDVGPA 233
                   ||   :||....::.|.|....::.|||...|.|....|:.:.:|.:|...:...||.
Human   331 KECPEYTVR---QLTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPI 392

  Fly   234 VVHCSAGIGRSGTFCLVDCCLVLIDKYGECNVSKVLCELRSYRM--------------------- 277
            ||||||||||:|.|.........:...||.::..::|:||..|:                     
Human   393 VVHCSAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQLRLDRLLERRKLEAQEYSWPDPRLQRS 457

  Fly   278 -------------------------GLIQTADQLDFSYQAIIEGIKKLHDPTFLDA----EEP 311
                                     |:||||:|..|           ||....|.|    |||
Human   458 GFVPGAEWIKEDQVSTWGITPQHVGGMIQTAEQYQF-----------LHHTLALYAGQLPEEP 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 84/301 (28%)
PTPc 62..295 CDD:238006 83/297 (28%)
PTPN7XP_011508121.1 PTPc 201..499 CDD:214550 86/311 (28%)
PTPc 227..499 CDD:238006 85/308 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.