DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp61F and ptpn5

DIOPT Version :9

Sequence 1:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster
Sequence 2:XP_009301648.1 Gene:ptpn5 / 559524 ZFINID:ZDB-GENE-101028-3 Length:529 Species:Danio rerio


Alignment Length:285 Identity:88/285 - (30%)
Similarity:144/285 - (50%) Gaps:30/285 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QIEAEYKDKGPQWHRFYKEICETCDREAKEKQFSTSESERHTNRGLNRYRDVNPYDHSRIVLK-- 80
            |:.....|.|.....||    ||.......|::|.....|.     |||:.:.|..|||:.||  
Zfish   253 QLHTRALDDGVLQAEFY----ETPMNFVDPKEYSIPGVVRK-----NRYKTILPNTHSRVCLKAK 308

  Fly    81 -RGSV--DYINANLVQ-LERAERQYILTQGPLVDTVGHFWLMVWEQKSRAVLMLNKLMEKKQIKC 141
             .|..  .|||||.:: ....|:.||.||||.|:|||.||.|||:::...::|:..:.||.: ||
Zfish   309 EEGDFLSTYINANYLKGYGGKEKAYIATQGPTVNTVGDFWRMVWQERCPIIVMITNIEEKNE-KC 372

  Fly   142 HLYWPNEMGADKALKLPHVKLTV-ELVRLETYQNFVRRWFKLTDLETQ-QSREVMQFHYTTWPDF 204
            ..|||.:     ::....:::|| ::::.:.|.      .::..:::: :.|.:.|:.||:|||.
Zfish   373 TEYWPED-----SVTCEGIEITVKQVIQADDYS------LRIFTVKSEGEERSLRQYWYTSWPDQ 426

  Fly   205 GIPSSPNAFLKFLQQVRDSGCLS-RDVGPAVVHCSAGIGRSGTFCLVDCCLVLIDKYGECNVSKV 268
            ..|......|:.:|:|.::...: .:.||.:|||||||||:|.|.........:...|..::.|.
Zfish   427 KTPDKAPPLLELVQEVEEARKQAPPNSGPVIVHCSAGIGRTGCFIATSILCQQLSNEGVVDILKT 491

  Fly   269 LCELRSYRMGLIQTADQLDFSYQAI 293
            ..:||..|.|:||||:|..|.:..:
Zfish   492 TSQLRLDRGGMIQTAEQYQFVHHVL 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 84/269 (31%)
PTPc 62..295 CDD:238006 78/241 (32%)
ptpn5XP_009301648.1 PTPc 264..516 CDD:214550 85/272 (31%)
PTPc 289..516 CDD:238006 78/243 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.