DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp61F and Ptp52F

DIOPT Version :9

Sequence 1:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_611093.2 Gene:Ptp52F / 36790 FlyBaseID:FBgn0034085 Length:1433 Species:Drosophila melanogaster


Alignment Length:383 Identity:107/383 - (27%)
Similarity:168/383 - (43%) Gaps:78/383 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 FYKEIC--ETCDREAKE-----KQFSTSESERHTNRGLNRYRDVNPYDHSRIVL---KRGSVDYI 87
            ||.|:.  |...||.||     .:.|.|.||...::  |||.|:.|||.:|::|   ..|| |||
  Fly  1091 FYTEVAKPEKLAREFKEITVVALELSYSASELGCHK--NRYADIFPYDKNRVILDIDAEGS-DYI 1152

  Fly    88 NANLVQLERAERQYILTQGPLVDTVGHFWLMVWEQKSRAVLMLNKLMEKKQIKCHLYWP-NEMGA 151
            ||:.:.....:::||.||||..::|..||.|:.:...|.::.:.:..|...||||.|:| |..|.
  Fly  1153 NASFIDGHTRKKEYIATQGPKPESVMDFWRMILQYNVRVIVQVTQFREGNTIKCHEYYPYNVRGL 1217

  Fly   152 DKALKLPHVKLTVELVRLETYQNFVRRWFKLTDLETQQSR-----EVMQFHYTTWPDFGIPSSPN 211
            ...:|...|        ||.|..        |:|.....:     :|:.:::..|||.|:|..|.
  Fly  1218 TVTIKSKEV--------LELYDR--------TELTVVHDKYGLKEKVIHYYFKKWPDHGVPEDPM 1266

  Fly   212 AFLKFLQQVRDSGCLSRDVGPAVVHCSAGIGRSGTFCLVDCCLVLIDKYGECNVSKVLCELRSYR 276
            ..:.|:::|:.....|  ..|.|||||||:||:|||..:|..:..:....:.|:.:.:.:||..|
  Fly  1267 HLIMFVKKVKAEKRPS--YSPIVVHCSAGVGRTGTFIGLDLIMQRLKSESKINIFETVKKLRFQR 1329

  Fly   277 MGLIQTADQLDFSYQAIIEGIKKLHDPTFLDAEEPLISNDTETHTLDELPPPLPPRVQSLNLPLA 341
            |.::||..|..|.|....|.:|                     |.:......:..|.:|:.:|..
  Fly  1330 MKMVQTQQQYTFLYACTYELVK---------------------HKIPRAALKMDGRPKSVTVPAI 1373

  Fly   342 PNSGGILSLNMRAAQANGAESIGKELSKDALNNFINQHDMIHDAEVADSRPLPPLPVR 399
            |:...:...::         .:|.|....|         .|.|.:  |.||:..||.|
  Fly  1374 PSPKKVSFPDV---------DVGSEYVSSA---------PITDLD--DGRPIVQLPSR 1411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 88/276 (32%)
PTPc 62..295 CDD:238006 77/241 (32%)
Ptp52FNP_611093.2 FN3 648..749 CDD:238020
PTPc 1100..1345 CDD:214550 85/265 (32%)
PTPc 1125..1348 CDD:238006 77/243 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443551
Domainoid 1 1.000 133 1.000 Domainoid score I1104
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46470
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.