DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp61F and Y62F5A.10

DIOPT Version :9

Sequence 1:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001022486.1 Gene:Y62F5A.10 / 3564988 WormBaseID:WBGene00013388 Length:437 Species:Caenorhabditis elegans


Alignment Length:239 Identity:48/239 - (20%)
Similarity:99/239 - (41%) Gaps:20/239 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 DVNPYDHSRIVLKRGSVD-YINANLVQLERAERQYILTQGPLVDTVGHFWLMVWEQKSRAVLMLN 131
            ||.|...:.:|......| |:|.:.|.:.......::.|.|.......||...:.::   |:|:.
 Worm   181 DVYPILDATLVKDPAKPDSYVNMSSVIVPHCSYPILMGQIPKRGLEEEFWRAAYNEQ---VVMMY 242

  Fly   132 KLMEKKQIKCHLYWPNEMGADKALKLPHVKLTVELVRLETYQNFVRRWFKLTDLETQQSREVMQ- 195
            .|:..:..| :.::|...|:    .|.:.::.|.:.::|.... .|..:.:..|....|..||. 
 Worm   243 VLVGSEDEK-YDFFPKTTGS----FLYYGEMFVNVRKVEKMDE-ERSRYTIEVLPNGFSNSVMMN 301

  Fly   196 -FHYTTWPDFGIP----SSPNAFLKFLQQVRDSGCLSRDVGPAVVHCSAGIGRSGTFCLVDCCLV 255
             :.:|.|..||:|    ::..:.:..:..|:.|....:    .:|....|.||:|.|..:.....
 Worm   302 VYVHTGWEPFGVPIRYANTTRSVVDVMNFVKSSNGSEK----LLVVSKNGCGRAGFFITLGAAFC 362

  Fly   256 LIDKYGECNVSKVLCELRSYRMGLIQTADQLDFSYQAIIEGIKK 299
            .::...|..:.:::..:||.|...:::..|....|..::..|||
 Worm   363 CLNDNSEPRIGEIVKAIRSQRPNAVESIKQYASLYLCLLYYIKK 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 45/233 (19%)
PTPc 62..295 CDD:238006 45/233 (19%)
Y62F5A.10NP_001022486.1 PTPc 162..402 CDD:214550 45/233 (19%)
PTPc 177..402 CDD:304379 45/233 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.