DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp61F and Lar

DIOPT Version :9

Sequence 1:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001260594.1 Gene:Lar / 35259 FlyBaseID:FBgn0000464 Length:2032 Species:Drosophila melanogaster


Alignment Length:292 Identity:104/292 - (35%)
Similarity:149/292 - (51%) Gaps:39/292 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KQFSTSESERHTNRGLNRYRDVNPYDHSRIVLKR-----GSVDYINANLVQLERAERQYILTQGP 107
            :||:...|....|:..|||.:|..|||||:.|..     || ||||||.....|....|:.||||
  Fly  1488 QQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGS-DYINANYCDGYRKHNAYVATQGP 1551

  Fly   108 LVDTVGHFWLMVWEQKSRAVLMLNKLMEKKQIKCHLYWPNEMGADKALKLPHVKLTVELVRLETY 172
            |.:|...||.|.||.|:..::|:.:|.|:.:|||..|||.. |.:     .:.::.|.:...:..
  Fly  1552 LQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTR-GTE-----TYGQIFVTITETQEL 1610

  Fly   173 QNFVRRWFKLTDLETQQSREVMQFHYTTWPDFGIPSSPNAFLKFLQQVRDSGCLSRDVGPAVVHC 237
            ..:..|.|:|........||:.|..:|.|||.|:|..|..||:||::.|  .....:.||.:|||
  Fly  1611 ATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCR--ALTPPESGPVIVHC 1673

  Fly   238 SAGIGRSGTFCLVDCCL------VLIDKYGECNVSKVLCELRSYRMGLIQTADQLDFSYQAIIEG 296
            |||:||:|.:.::|..|      .:||.||.     |.| ||:.|..::||.||..|.:.||:|.
  Fly  1674 SAGVGRTGCYIVIDSMLERMKHEKIIDIYGH-----VTC-LRAQRNYMVQTEDQYIFIHDAILEA 1732

  Fly   297 I---------KKLHDPTFLDAEEPLISNDTET 319
            |         :.||  |.|  ::.||:...||
  Fly  1733 IICGVTEVPARNLH--THL--QKLLITEPGET 1760

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 94/257 (37%)
PTPc 62..295 CDD:238006 90/243 (37%)
LarNP_001260594.1 Ig 35..129 CDD:299845
I-set 36..129 CDD:254352
IG_like 146..227 CDD:214653
Ig 159..228 CDD:299845
I-set 234..318 CDD:254352
Ig3_RPTP_IIa_LAR_like 249..317 CDD:143216
fn3 324..404 CDD:278470
FN3 423..514 CDD:238020
FN3 520..610 CDD:238020
FN3 616..707 CDD:238020
FN3 712..810 CDD:238020
FN3 832..907 CDD:238020
FN3 914..1005 CDD:238020
FN3 1012..1101 CDD:238020
fn3 1106..1198 CDD:278470
PTPc 1476..1731 CDD:214550 94/257 (37%)
PTPc 1503..1731 CDD:238006 90/242 (37%)
PTPc 1763..2022 CDD:214550
PTPc 1791..2022 CDD:238006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443549
Domainoid 1 1.000 133 1.000 Domainoid score I1104
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46470
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.