DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp61F and Lar

DIOPT Version :10

Sequence 1:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001260594.1 Gene:Lar / 35259 FlyBaseID:FBgn0000464 Length:2032 Species:Drosophila melanogaster


Alignment Length:291 Identity:104/291 - (35%)
Similarity:149/291 - (51%) Gaps:37/291 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KQFSTSESERHTNRGLNRYRDVNPYDHSRIVLK--RGSV--DYINANLVQLERAERQYILTQGPL 108
            :||:...|....|:..|||.:|..|||||:.|.  .|.|  ||||||.....|....|:.|||||
  Fly  1488 QQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNAYVATQGPL 1552

  Fly   109 VDTVGHFWLMVWEQKSRAVLMLNKLMEKKQIKCHLYWPNEMGADKALKLPHVKLTVELVRLETYQ 173
            .:|...||.|.||.|:..::|:.:|.|:.:|||..|||.. |.:     .:.::.|.:...:...
  Fly  1553 QETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTR-GTE-----TYGQIFVTITETQELA 1611

  Fly   174 NFVRRWFKLTDLETQQSREVMQFHYTTWPDFGIPSSPNAFLKFLQQVRDSGCLSRDVGPAVVHCS 238
            .:..|.|:|........||:.|..:|.|||.|:|..|..||:||::.|  .....:.||.:||||
  Fly  1612 TYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCR--ALTPPESGPVIVHCS 1674

  Fly   239 AGIGRSGTFCLVDCCL------VLIDKYGECNVSKVLCELRSYRMGLIQTADQLDFSYQAIIEGI 297
            ||:||:|.:.::|..|      .:||.||.     |.| ||:.|..::||.||..|.:.||:|.|
  Fly  1675 AGVGRTGCYIVIDSMLERMKHEKIIDIYGH-----VTC-LRAQRNYMVQTEDQYIFIHDAILEAI 1733

  Fly   298 ---------KKLHDPTFLDAEEPLISNDTET 319
                     :.||  |.|  ::.||:...||
  Fly  1734 ICGVTEVPARNLH--THL--QKLLITEPGET 1760

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp61FNP_476687.1 PTPc-N1_2 63..291 CDD:350393 88/237 (37%)
LarNP_001260594.1 I-set 36..129 CDD:400151
Ig strand B 53..57 CDD:409353
Ig strand C 66..70 CDD:409353
Ig strand E 93..97 CDD:409353
Ig strand F 108..113 CDD:409353
Ig strand G 122..125 CDD:409353
Ig 141..228 CDD:472250
Ig strand B 157..161 CDD:409353
Ig strand C 170..174 CDD:409353
Ig strand E 192..196 CDD:409353
Ig strand F 206..211 CDD:409353
Ig strand G 218..221 CDD:409353
IgI_3_RPTP_IIa_LAR_like 237..319 CDD:409401
Ig strand A 237..239 CDD:409401
Ig strand A' 244..248 CDD:409401
Ig strand B 251..259 CDD:409401
Ig strand C 264..270 CDD:409401
Ig strand C' 272..274 CDD:409401
Ig strand D 277..281 CDD:409401
Ig strand E 286..291 CDD:409401
Ig strand F 298..305 CDD:409401
Ig strand G 309..318 CDD:409401
FN3 322..411 CDD:238020
FN3 <382..747 CDD:442628
FN3 712..810 CDD:238020
FN3 832..898 CDD:214495
FN3 <867..1269 CDD:442628
fn3 914..998 CDD:394996
R-PTPc-LAR-1 1498..1735 CDD:350401 93/250 (37%)
R-PTP-LAR-2 1784..2021 CDD:350402
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.