DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp61F and Ptpmeg2

DIOPT Version :9

Sequence 1:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_572576.1 Gene:Ptpmeg2 / 31907 FlyBaseID:FBgn0028341 Length:827 Species:Drosophila melanogaster


Alignment Length:324 Identity:114/324 - (35%)
Similarity:168/324 - (51%) Gaps:39/324 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QIEAEYKDKGPQWHRFYKEICETCDREAKEKQFSTSESERHTNRGLNRYRDVNPYDHSRIVLKRG 82
            ||....|.:|.  |...||..:..:| |.|..|  ..:....|...|||.||..|||||:||...
  Fly   520 QIVQMVKQRGR--HGLIKEYADIRNR-APEGTF--LHARMRANLTKNRYTDVLCYDHSRVVLAHE 579

  Fly    83 S----VDYINANLVQLERAERQYILTQGPLVDTVGHFWLMVWEQKSRAVLMLNKLMEKKQIKCHL 143
            .    .||||||.|...:.:..||.|||||..|...||.|:|||....::|..::||:.::||..
  Fly   580 DGDEPSDYINANFVDGYKQKNAYISTQGPLPKTSQDFWRMIWEQHCLVIVMTTRVMERGRVKCGQ 644

  Fly   144 YW-PNEMGADKALKLP--HVKLTVELVRLETYQNFVRRWFKLTDLETQQSREVMQFHYTTWPDFG 205
            || |.|   :.:|:..  ||:    .:.:|..::::....:|.:::|.:.|.|..:.:|:|||:|
  Fly   645 YWEPTE---ESSLEFGDYHVR----TISVECNEDYMVASLELRNIKTDEIRNVSHWQFTSWPDYG 702

  Fly   206 IPSSPNAFLKFLQQVRDSGC-LSRDVG----------PAVVHCSAGIGRSGTFCLVDCCLVLIDK 259
            :|||..|.|.|||:||:... |.:.:|          |.||||||||||:|||..:|.|:..::.
  Fly   703 VPSSAMAMLNFLQKVREKQAQLVQGLGDTWAGHPRGPPIVVHCSAGIGRTGTFITLDICISRLED 767

  Fly   260 YGECNVSKVLCELRSYRMGLIQTADQLDFSYQAIIE-----GIKKLHDPTFLDAEEPLISNDTE 318
            .|..::...:.::||.|...||..||..|.:.|:||     |:.:..|....|..||    |:|
  Fly   768 VGTADIRGTVEKIRSQRAYSIQMPDQYVFCHLALIEYAYSRGMLQTVDLAGFDEREP----DSE 827

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 100/278 (36%)
PTPc 62..295 CDD:238006 93/250 (37%)
Ptpmeg2NP_572576.1 CRAL_TRIO_N <114..144 CDD:215024
SEC14 170..314 CDD:238099
Y_phosphatase 557..803 CDD:278528 94/252 (37%)
PTPc 559..803 CDD:238006 93/250 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443546
Domainoid 1 1.000 133 1.000 Domainoid score I1104
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000704
OrthoInspector 1 1.000 - - otm46470
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.