DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp61F and Ptpn5

DIOPT Version :9

Sequence 1:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster
Sequence 2:XP_038965611.1 Gene:Ptpn5 / 29644 RGDID:3448 Length:613 Species:Rattus norvegicus


Alignment Length:246 Identity:79/246 - (32%)
Similarity:126/246 - (51%) Gaps:35/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 NRYRDVNPYDHSRIVLKRGSVD-----YINANLVQ-LERAERQYILTQGPLVDTVGHFWLMVWEQ 122
            |||:.:.|..|||:.|.....:     |||||.:: ....|:.||.||||:|.||..||.|||::
  Rat   374 NRYKTILPNPHSRVRLTSPDPEDPLSSYINANYIRGYNGEEKVYIATQGPIVSTVADFWRMVWQE 438

  Fly   123 KSRAVLMLNKLMEKKQIKCHLYWPNEMGADKALKLPH--VKLTVE-LVRLETYQNFVRRWFKLTD 184
            ::..::|:..:.|..: ||..|||.|       ::.|  |::||: ::..|.|:      .:|..
  Rat   439 RTPIIVMITNIEEMNE-KCTEYWPEE-------QVVHDGVEITVQKVIHTEDYR------LRLIS 489

  Fly   185 LET-QQSREVMQFHYTTWPDFGIPSSPNAFLKFLQQVRDSG------CLSRDVGPAVVHCSAGIG 242
            |.. .:.|.:..:.:|:|||...|......|..:::|.::.      |     .|.:||||||||
  Rat   490 LRRGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHC-----SPIIVHCSAGIG 549

  Fly   243 RSGTFCLVDCCLVLIDKYGECNVSKVLCELRSYRMGLIQTADQLDFSYQAI 293
            |:|.|.....|...:.:.|..::.|..|:||..|.|:|||.:|..|.:.|:
  Rat   550 RTGCFIATSICCQQLRREGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHAM 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 79/246 (32%)
PTPc 62..295 CDD:238006 79/246 (32%)
Ptpn5XP_038965611.1 PTPc-N5 346..603 CDD:350461 79/246 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.