DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp61F and pyp3

DIOPT Version :9

Sequence 1:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_594934.1 Gene:pyp3 / 2541443 PomBaseID:SPAC11E3.09 Length:303 Species:Schizosaccharomyces pombe


Alignment Length:263 Identity:89/263 - (33%)
Similarity:139/263 - (52%) Gaps:50/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 NRYRDVNPYDHSRIVLK---RGSVDYINANLVQLERAERQYILTQGPLVDTVGHFWLMVWEQ--K 123
            |||.::.||:::|:.|.   :.:.|||||::|::. :.:.:|.||||..:::..||.|||:.  |
pombe    53 NRYSNIVPYENTRVRLDPMWKEACDYINASIVKIP-SGKTFIATQGPTSNSIDVFWKMVWQSVPK 116

  Fly   124 SRAVLMLNKLMEKKQIKCHLYWPNEMGADKALKLPHVKLTVELVRLETYQNFVRRWFKLTDLETQ 188
            |..::||.||.|:.::||.:|||.|:  .:.|.:.  .|:|.||::.|          ||.|...
pombe   117 SGIIVMLTKLRERHRLKCDIYWPVEL--FETLNIG--DLSVILVKVYT----------LTSLNEV 167

  Fly   189 QSRE-----------VMQFHYTTWPDFGIPS-----SPNAFLKFLQQVRDSGCLSRDVGPAVVHC 237
            |.||           ::.|:|..|||||.|.     |...::|.|....|.     :..|.:|||
pombe   168 QVREFELNKDGVKKKILHFYYNGWPDFGAPHTFSLLSLTRYIKSLSYSPDF-----ETAPIIVHC 227

  Fly   238 SAGIGRSGTFCLVDCCLVLID------KYGECNVSKVLCELRSYRMGLIQTADQLDFSY---QAI 293
            |||.||:|||..:...|...|      |:...|::.::..|||.||..:|:.|||.|.|   |.:
pombe   228 SAGCGRTGTFMALFEILSQTDDSTSTSKFEVDNIANIVSSLRSQRMQSVQSVDQLVFLYTVSQEL 292

  Fly   294 IEG 296
            ::|
pombe   293 LQG 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 88/260 (34%)
PTPc 62..295 CDD:238006 88/260 (34%)
pyp3NP_594934.1 COG5599 1..303 CDD:227886 89/263 (34%)
AbiGii_2 <18..69 CDD:293478 6/15 (40%)
PTPc 52..291 CDD:238006 87/257 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000704
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.