DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp61F and Ptpn7

DIOPT Version :9

Sequence 1:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster
Sequence 2:XP_006249882.1 Gene:Ptpn7 / 246781 RGDID:708516 Length:405 Species:Rattus norvegicus


Alignment Length:283 Identity:89/283 - (31%)
Similarity:134/283 - (47%) Gaps:51/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 HTNRGLNRYRDVNPYDHSRIVLKRG----SVDYINANLVQ-LERAERQYILTQGPLVDTVGHFWL 117
            |.::  :||:.:.|...||:.|.|.    ..||||||.:: .:..|:.||.||||:.:||..||.
  Rat   165 HASK--DRYKTILPNPQSRVCLGRAHSQEDSDYINANYIRGYDGKEKVYIATQGPMPNTVADFWE 227

  Fly   118 MVWEQKSRAVLMLNKLMEKKQIKCHLYWPNEMGADKALKLPHVKLTVELVRLETYQNFVRRWFKL 182
            |||::....::||.:|.|.|: ||..|||.|..|       :....:.:..::.:..:..|  .|
  Rat   228 MVWQEDVSLIVMLTQLREGKE-KCVHYWPTEEEA-------YGPFQIRIQGMKEHPEYTVR--HL 282

  Fly   183 TDLETQQSREVMQFHYTTWPDFGIPSSPNAFLKFLQQVRDSGCLSRDVGPAVVHCSAGIGRSGTF 247
            |....|:.|.|....::.|||...|.|....|:.:.:| ::...:.:.||.||||||||||:|.|
  Rat   283 TIQHQQECRSVKHILFSAWPDHQTPESAGPLLRLVAEV-ETPETAANSGPIVVHCSAGIGRTGCF 346

  Fly   248 CLVDCCLVLIDKYGECNVSKVLCELRSYRMGLIQTADQLDFSYQAIIEGIKKLHDPTFLDAEEPL 312
            .........:...||.::..::|:||..|.|:||||:|..|           ||           
  Rat   347 IATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQF-----------LH----------- 389

  Fly   313 ISNDTETHTL----DELPPPLPP 331
                   |||    .:|||...|
  Rat   390 -------HTLALYAAQLPPETDP 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 80/241 (33%)
PTPc 62..295 CDD:238006 79/237 (33%)
Ptpn7XP_006249882.1 PTPc 142..393 CDD:214550 84/269 (31%)
PTPc 168..393 CDD:238006 83/266 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.