DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp61F and Ptprz1

DIOPT Version :9

Sequence 1:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster
Sequence 2:XP_006505075.1 Gene:Ptprz1 / 19283 MGIID:97816 Length:2318 Species:Mus musculus


Alignment Length:409 Identity:126/409 - (30%)
Similarity:186/409 - (45%) Gaps:86/409 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 FYKEICETCDREAKEKQFSTSESERH-TNRGLNRYRDVNPYDHSRIVL-----KRGSV-DYINAN 90
            ||:|: ::|..:..    .|::|..| .|:..|||.::..|||||:.|     |.|.: ||||||
Mouse  1724 FYQEV-QSCTADLG----ITADSSNHPDNKHKNRYVNIVAYDHSRVKLTQLAEKDGKLTDYINAN 1783

  Fly    91 LVQLERAERQYILTQGPLVDTVGHFWLMVWEQKSRAVLMLNKLMEKKQIKCHLYWPNEMGADKAL 155
            .|......:.||..||||..|...||.|:||.....::|:..|:||.:.||..|||.:...:...
Mouse  1784 YVDGYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPTDGSEEYGS 1848

  Fly   156 KLPHVKLTVELVRLETYQNFVRRWFKLTDLE-----TQQSRE----VMQFHYTTWPDFGIPSSPN 211
            .|.:.| :|:::...|.:||..|..||..|.     :|:.|.    |.|:|||.|||.|:|....
Mouse  1849 FLVNQK-SVQVLAYYTVRNFTLRNTKLKKLSELFQGSQKGRSSGRLVTQYHYTQWPDMGVPEYSL 1912

  Fly   212 AFLKFLQQVRDSGCLSRD-VGPAVVHCSAGIGRSGTFCLVDCCLVLIDKYGECNVSKVLCELRSY 275
            ..|.|   ||.:....|. |||.|||||||:||:||:.::|..|..|...|..|:...|..:||.
Mouse  1913 PVLAF---VRKAAQAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQ 1974

  Fly   276 RMGLIQTADQLDFSYQAIIEGIKKLHDPTFLDAEEPLISNDTE---------THTLDELPPP--- 328
            |..|:||.:|..|.:..::|.|               :|.:||         .:|| .:|.|   
Mouse  1975 RNYLVQTEEQYVFIHDTLVEAI---------------LSKETEVPDSHIHSYVNTL-LIPGPTGK 2023

  Fly   329 --LPPRVQSLN--------------------------LPLAPNSGGILSLNMRAAQ-ANGAESIG 364
              |..:.|.|:                          :|:..:..||.||:..... .|.:..:|
Mouse  2024 TKLEKQFQLLSQSNILQSDYSTALKQCNREKNRTSSIIPVERSRVGISSLSGEGTDYINASYIMG 2088

  Fly   365 KELSKDALNNFINQHDMIH 383
            ...|.:.:   |.||.::|
Mouse  2089 YYQSNEFI---ITQHPLLH 2104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 101/277 (36%)
PTPc 62..295 CDD:238006 94/248 (38%)
Ptprz1XP_006505075.1 alpha_CARP_receptor_like 45..298 CDD:239396
fn3 313..395 CDD:365830
PTP_DSP_cys 1714..1997 CDD:391942 104/296 (35%)
R-PTP-Z-2 2080..2283 CDD:350507 7/28 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.