DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp61F and Ptprf

DIOPT Version :10

Sequence 1:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster
Sequence 2:XP_006502927.1 Gene:Ptprf / 19268 MGIID:102695 Length:1924 Species:Mus musculus


Alignment Length:325 Identity:120/325 - (36%)
Similarity:167/325 - (51%) Gaps:58/325 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KQFSTSESERHTNRGLNRYRDVNPYDHSRIVLKR-----GSVDYINANLVQLERAERQYILTQGP 107
            :||:...|....|:..|||.:|..|||||::|..     || ||||||.:...|.:..||.||||
Mouse  1380 QQFTWENSNSEVNKPKNRYANVIAYDHSRVLLTSIDGVPGS-DYINANYIDGYRKQNAYIATQGP 1443

  Fly   108 LVDTVGHFWLMVWEQKSRAVLMLNKLMEKKQIKCHLYWPNEMGADKALKLPHVKLTVELVRLETY 172
            |.:|:|.||.|||||::..|:|:.:|.||.::||..|||  :...:...|..|.| |:.|.|.||
Mouse  1444 LPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWP--VRGTETYGLIQVTL-VDTVELATY 1505

  Fly   173 QNFVRRWFKLTDLETQQSREVMQFHYTTWPDFGIPSSPNAFLKFLQQVRDSGCLSRDVGPAVVHC 237
               ..|.|.|....:.:.||:.||.:..|||.|:|..|...|.||::|:  .|...|.||.||||
Mouse  1506 ---TMRTFALHKSGSSEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVK--ACNPLDAGPMVVHC 1565

  Fly   238 SAGIGRSGTFCLVDCCL------VLIDKYGECNVSKVLCELRSYRMGLIQTADQLDFSYQAIIEG 296
            |||:||:|.|.::|..|      ..:|.||.     |.| :||.|..::||.||..|.::|::|.
Mouse  1566 SAGVGRTGCFIVIDAMLERMKHEKTVDIYGH-----VTC-MRSQRNYMVQTEDQYVFIHEALLEA 1624

  Fly   297 ----------------IKKL------HDPTFLDAEEPLISNDTETHTLDELPPPLPPRVQSLNLP 339
                            |:||      ...|.::.|..|::| ::.||         .|..|.|||
Mouse  1625 AMCGHTEVLARNLYAHIQKLGQVPPGESVTAMELEFKLLAN-SKAHT---------SRFVSANLP 1679

  Fly   340  339
            Mouse  1680  1679

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp61FNP_476687.1 PTPc-N1_2 63..291 CDD:350393 100/238 (42%)
PtprfXP_006502927.1 I-set 33..124 CDD:400151
Ig strand B 50..54 CDD:409353
Ig strand C 63..67 CDD:409353
Ig strand E 86..93 CDD:409353
Ig strand F 104..109 CDD:409353
Ig strand G 117..120 CDD:409353
IgI_2_RPTP_IIa_LAR_like 136..232 CDD:409400
Ig strand A 136..138 CDD:409400
Ig strand A' 143..147 CDD:409400
Ig strand B 150..159 CDD:409400
Ig strand C 164..170 CDD:409400
Ig strand C' 172..174 CDD:409400
Ig strand D 183..187 CDD:409400
Ig strand E 196..201 CDD:409400
Ig strand F 210..217 CDD:409400
Ig strand G 220..231 CDD:409400
IgI_3_RPTP_IIa_LAR_like 241..322 CDD:409401
Ig strand A 241..243 CDD:409401
Ig strand A' 247..251 CDD:409401
Ig strand B 254..262 CDD:409401
Ig strand C 267..273 CDD:409401
Ig strand C' 275..277 CDD:409401
Ig strand D 280..284 CDD:409401
Ig strand E 289..294 CDD:409401
FN3 294..718 CDD:442628
Ig strand F 301..308 CDD:409401
Ig strand G 312..321 CDD:409401
FN3 598..1065 CDD:442628
PTP_DSP_cys 1352..1627 CDD:475123 106/261 (41%)
R-PTP-F-2 1629..1919 CDD:350477 14/61 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.