DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp61F and ZK616.8

DIOPT Version :9

Sequence 1:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_500807.3 Gene:ZK616.8 / 191362 WormBaseID:WBGene00022778 Length:160 Species:Caenorhabditis elegans


Alignment Length:141 Identity:29/141 - (20%)
Similarity:44/141 - (31%) Gaps:60/141 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RHTNRGLNRYRDVNPYDHSRIVLKRGSVD-YINANLVQLERAERQYILTQGPLVDTVGHFWLMVW 120
            |.|::...||...:|     ...:||..| ::.||...|           |||.           
 Worm    55 RATDKQALRYSHTHP-----TPFQRGHSDLFVMANQPSL-----------GPLT----------- 92

  Fly   121 EQKSRAVLMLNKLMEKKQIKCHLYWPNEMGADKALKLPHVKLTVELVRLETYQ--NFVRRWFKLT 183
                               .|.:::.   ||.:||..|....|:.:...|..:  ||.|      
 Worm    93 -------------------CCEIHYD---GAKEALGTPWKFHTINIFHHENRRVYNFQR------ 129

  Fly   184 DLETQQSREVM 194
              :.|||.|.:
 Worm   130 --DEQQSTETV 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 29/141 (21%)
PTPc 62..295 CDD:238006 27/136 (20%)
ZK616.8NP_500807.3 PLAT 26..127 CDD:381752 22/120 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.