DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp61F and Y116A8C.37

DIOPT Version :9

Sequence 1:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_503038.1 Gene:Y116A8C.37 / 191006 WormBaseID:WBGene00013810 Length:298 Species:Caenorhabditis elegans


Alignment Length:160 Identity:35/160 - (21%)
Similarity:53/160 - (33%) Gaps:59/160 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 LSLNMRAAQANGAESIGKELSKDALNNFINQHDMIHDAEVADSRPLPPLPVRAFNDSDSDEDYLL 412
            :.:|.|..||...:.: :||.|                 |.|.:           :.||....|.
 Worm     9 VKVNRRNRQARKVKKV-EELGK-----------------VVDRK-----------EMDSPLGRLY 44

  Fly   413 DDDDEDDTDEDEEYETINEHDADPVNGHVPA----------TTQPHADDVNANNEKPAVPVD--- 464
            ::..|:..:|.:|.      |.:|.:|..||          ||.........:|.|  .|:|   
 Worm    45 EEKKEERKEEKKEV------DKEPWSGEEPAKRMVANGFFTTTNVGGTFKQTDNFK--TPMDSCP 101

  Fly   465 ----EQHKANGID-PIPGQ----LPASPEN 485
                ..||....| |||.:    |...||:
 Worm   102 SFKNNMHKIRAPDCPIPEEKLVKLANGPES 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550
PTPc 62..295 CDD:238006
Y116A8C.37NP_503038.1 PTPc 87..283 CDD:214550 13/47 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.