DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp61F and C17H12.5

DIOPT Version :9

Sequence 1:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_501047.1 Gene:C17H12.5 / 182754 WormBaseID:WBGene00015931 Length:443 Species:Caenorhabditis elegans


Alignment Length:289 Identity:53/289 - (18%)
Similarity:108/289 - (37%) Gaps:59/289 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EICETC-------DREAK--EKQFSTSESERHTNRGLNRYRDVNPYDHSRIVLKRGSVD-YINAN 90
            |..|.|       |::.:  :|....::::.:            |...|.||......| |:|.:
 Worm   158 EYIEACAATKVNIDKDCQLWKKNLQMNQADNY------------PILDSTIVKNPAQPDSYVNMS 210

  Fly    91 LVQLERAERQYILTQGPLVDTVGHFWLMVWEQKSRAVLMLNKLMEKKQIKCHLYWPNEMGADKAL 155
            .|.:.......::.|.|.......||...:.:   :|:::..||..:..| :.::|..|||    
 Worm   211 SVIVPHCRYPILMAQMPKRGFEEEFWRAAFNE---SVVIMYVLMGTEDEK-NDFFPTTMGA---- 267

  Fly   156 KLPHVKLTVELVRLETYQNFVRRWFKLTDLETQQSREVMQ-----------FHYTTWPDFGIP-- 207
               :|......|.       :|:..|:.:..|:.:.||:.           :.:|.|...|:|  
 Worm   268 ---YVYYGAMFVN-------IRKVEKMDEERTRYTIEVLPNGFSNSVMMNVYVHTGWEASGVPVR 322

  Fly   208 --SSPNAFLKFLQQVRDSGCLSRDVGPAVVHCSAGIGRSGTFCLVDCCLVLIDKYGECNVSKVLC 270
              ::..:.:..:..|:.|....:    .:|....|.||:|.|..:......::...|..:.:::.
 Worm   323 YANTTRSVVDVMNFVKTSSGTEK----MLVVSKNGCGRAGFFLSLGAAFCCLNDNSEPRIGEIVK 383

  Fly   271 ELRSYRMGLIQTADQLDFSYQAIIEGIKK 299
            .:||.|...:.:..|....|...:..|||
 Worm   384 AIRSQRPNAVDSIKQYASIYLCFVYYIKK 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 50/283 (18%)
PTPc 62..295 CDD:238006 45/248 (18%)
C17H12.5NP_501047.1 PTPc 155..408 CDD:214550 50/283 (18%)
PTPc 193..405 CDD:304379 44/233 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.